KEGG   Corynebacterium maris: B841_11200Help
Entry
B841_11200        CDS       T02784                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cmd  Corynebacterium maris
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cmd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B841_11200
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    B841_11200
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    B841_11200
Enzymes [BR:cmd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     B841_11200
Exosome [BR:cmd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B841_11200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2442671..2444113)
Genome map
AA seq 480 aa AA seqDB search
MAISPYALRTVATVSASAVVLAGALVPVANAQSSDGLNFPSSSLSSTPGQDNQEGTGGPK
NIIYMVGDGMGYNHVAAANLYESGQTRYQVEGEAAPEQLEELEGEAVQVYEGDDWNHLAM
ATFQEGNSYDGLRAWSDHNYVNEDFTDSAAAGTAMATGGKTSNGSLGVSSDGEAMENTSE
RAKAQGKAAGVVSDVPFSHATPAAWAAHNADRNDYHAIADEMLAGDLDVIMGAGHPLYGV
DNELLAEPNYRYISEEGFTAASTGETDFEYFEEDAAFEALANGEVEEGTQYFGLAQVAST
LQHDRTGASAVPYDVEQNDVIDLATMSEGALNALNTDDDGFHLMIEGGAIDWAGHANDIA
RDIEEVQAFNDTVDVVVEWVEENSSWDETLLIVTADHETGYLSGQDELPGWKALHGGAGE
VPEHEYYSGNHTNQVVPFFYKGAGSEDIAANVAGTDPVRGDYIDNTTVANLTFNEWWNED
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggctatttccccttatgcgctgcgcaccgtcgcaaccgtttccgcctccgccgtcgtg
ctcgccggtgctttggttcccgtcgccaacgcgcagagcagtgatgggctcaatttcccg
tcctcctcgctctcctccaccccgggccaggataatcaggaaggcacaggcggcccgaag
aacatcatttacatggtcggtgacggcatgggctacaaccacgtcgccgcagccaacctc
tacgagtccggccagaccaggtaccaggtcgagggtgaagccgctccggagcagctcgag
gagctggaaggcgaggccgtccaagtctacgagggcgacgactggaaccacttggcgatg
gccaccttccaagagggcaactcttacgacggtctgcgggcgtggagcgaccacaattac
gtcaacgaagacttcaccgactccgcggccgccggcaccgccatggccaccggcgggaag
accagcaacggctccctgggcgtcagctccgacggcgaggccatggagaacacctccgaa
cgcgccaaggcacagggcaaggccgccggcgtcgtctccgacgtcccgttcagccacgcc
accccggccgcctgggccgcgcacaatgccgaccgcaatgattaccatgccatcgccgac
gagatgctcgccggtgacctcgacgtcatcatgggcgccggacacccgctctacggcgtc
gacaacgagctgctggcggagccgaactaccgatacatttccgaagagggtttcacggcc
gcctccaccggcgagaccgatttcgagtacttcgaggaggacgccgcgtttgaggcgctg
gccaacggcgaagtcgaggaaggcacccagtactttggcctggcccaggtggcctccacc
ctgcagcatgaccgcaccggcgcttcggcggtcccgtacgacgtcgagcagaacgacgtc
atcgacctggccaccatgtccgagggtgcgctcaacgccctgaacaccgacgacgacggt
ttccacctcatgatcgaaggcggcgccatcgactgggcgggccacgccaacgacatcgcc
cgcgacatcgaggaagtccaggccttcaacgacactgtcgacgtcgtcgtcgaatgggtg
gaggagaattcctcctgggacgaaaccctgctgatcgtcaccgcggaccacgaaaccggc
tatctctccggacaggacgagctgccggggtggaaggcgctgcacggcggagcgggtgag
gtcccagagcacgagtactactccggcaaccacaccaaccaggtggtcccgttcttctac
aagggcgctggatccgaggacatcgccgccaacgtcgccggcaccgacccagtccgcggc
gactacatcgacaacaccaccgtcgcgaacctgacgttcaacgagtggtggaacgaagat
taa

DBGET integrated database retrieval system