KEGG   Cyanidioschyzon merolae: CYME_CMB025CHelp
Entry
CYME_CMB025C      CDS       T00175                                 

Definition
protoporphyrinogen IX oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cme  Cyanidioschyzon merolae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CYME_CMB025C
Enzymes [BR:cme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CYME_CMB025C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:60816..62543
Genome map
AA seq 575 aa AA seqDB search
MLRWSGSQQVTDRNRAEQHGLVVAFAFPARAPRHSEATHERWTGLAQRERGLCVPLKATK
WKRDLWHSRKLQMQEPAQRNREQVQALVVGSGVTGSSFAFLLQHAGISDVICTEARGEVG
GNLISRSKDGYLWEEGPNTFQPTPVILKLARDAGLESELVFADAKLPRYVYWEGVLHALP
SSPADLITGRFRLLSNAGKARAALGALGFVGAPKRVARQAGPEPSEDADLADESVEEFVT
RHLGREVFLKIIDPFVSGVYAGDPSKLSMAAAFKRVYALEQLGGTRGILEGALIRLQQRR
RERQRWAAENLPKVKAGALGSFREGLQQLPLTVATRLGPERMRTRYALRQIEYNGAKRGK
RRYTARFETPDGERVIETDALILTIPAHAASPLLQGLGVSGSELLQEIDFPPVYSVTLAY
PKFAARFPLNGFGNLIPRSAGIRTLGMVWSSSLFPERAPPDMNMVLSYIGGARDPGIREC
TPDEVAALVDADMRRVLLRADAPSPQVLGVRLWPRAIPQYNRGHLRRLEACNQGLQGFPG
LFLGGNYLSGVSFGDCVQWAYDNVPRVLTFLQETA
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgctcaggtggtccggatctcaacaggtaaccgaccggaaccgagccgaacagcatggc
ctggtcgtggcgttcgcttttcctgctcgagcaccgcgccacagcgaagcaacacacgag
cgctggactgggctggcgcagcgcgaacgcggcttgtgtgtaccgttgaaagcgaccaag
tggaaacgagacttgtggcactcgcgaaagcttcaaatgcaggagcctgcacagcggaac
agagagcaggtgcaagcgctagtagtaggctctggagtgactggctcttcgttcgcgttc
ctgctgcagcacgctggaataagcgatgtgatttgcaccgaggcacgaggtgaagttggt
ggaaaccttatttcgcgttccaaagacggctacctttgggaagaagggcccaacaccttc
caaccaacaccggtgattctgaaactcgcgcgagacgcgggtctcgagtccgagcttgtc
ttcgccgacgccaaactccctcgatacgtatactgggagggggttttgcacgcgctcccg
agttcgcctgcagacctgatcaccggccgtttccgcctgttatcgaatgcggggaaggct
cgggcagcgctcggagcgctcgggttcgtaggcgcacccaaacgcgtcgcacggcaagct
ggacccgagcccagcgaggatgctgacctagcagacgagtctgtagaggaattcgtgact
cgccatctaggccgcgaagttttcctgaagattatagaccccttcgtgagcggtgtgtat
gcaggcgatcccagcaaactctccatggctgcagctttcaagcgcgtgtacgcactcgag
cagcttggcggaacacgcgggattctcgaaggggcgctcatccgtctgcaacaacgtcga
cgggaacgtcaacgctgggcggcagagaatctccccaaggtgaaagcgggtgcactgggc
tccttccgcgagggcctgcagcagttgccgctcacagtggcgactcggctgggccctgag
cgaatgcgaactcggtatgcactgcgccaaattgaatacaatggagcaaaacgtggaaaa
cgtcgctatactgcccgcttcgaaaccccagatggcgaacgagttatcgaaacagatgcc
ctcattcttacgatccccgcacatgcggcgtcaccgctcttgcaaggtctgggtgtctct
gggagtgagctgctccaggaaatcgactttccgccggtatactcggtaactttggcatac
ccaaagtttgcagcgcggtttcccctaaacggtttcgggaacctgataccgcgctctgcc
ggtattcgcaccctcgggatggtctggtcgtcgagtttgtttccggaacgagcgcctccc
gatatgaatatggtgctctcatacatcggcggtgcgcgtgatcctggtatccgcgaatgc
accccggatgaagtcgctgccctcgtagacgcggacatgcgtcgcgtcctcctacgtgcc
gatgcaccttcgccgcaagttcttggtgtgagactttggccgcgggcgattccacaatac
aaccggggtcacttgcggcgcttggaagcctgcaaccagggtctacaaggctttcctggt
ctctttttaggcggaaactatctgagtggcgtttccttcggtgactgcgtacagtgggcg
tacgataatgtgcctcgagtgctgacgtttctgcaggagacggcttga

DBGET integrated database retrieval system