KEGG   Cyanidioschyzon merolae: CYME_CMF072CHelp
Entry
CYME_CMF072C      CDS       T00175                                 

Definition
glutamate decarboxylase
Orthology
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
cme  Cyanidioschyzon merolae
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cme00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cme00250]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:cme00410]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:cme00430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(join(187545..188540,188626..189315))
Genome map
AA seq 561 aa AA seqDB search
MPLHKTNVEKGGAKRFQHIDTSSLAFETGFASFALEEFPKYQLRAEPMPSAVAEGIITQE
LELDGNPALNLASFVTTRFDETTHKLCDRMLPVNWIDFDEYPQTVEIHNRCVNIIANLFH
APLEEGQQAVGTSTVGSSEAIMLAVLAMKWRWRAARKAAGKDYARPNMVMGSEVQVCWEK
ATAYFDVEPRYVPLHDDVYVMNPEKAIELCDENTIGICGILGTTYTGQFEDIATLDALVT
QMNEQKGFDIGIHVDAASGGFIAPFCYPNLRWDFRLKNVRSINVSGHKYGLAPCGIGWLI
FRSAAYLPEELVFHVNYLGADQASFTLNFSRGSAQIVASYYLLLRLGRRGYQNLMHTLKE
LASYFATRITEDGRFRLLSDNESLPLVAFAIPDDQRTKLGFDEFAIAGELRKRGWIVPAY
TLAPNLQHQKLLRVVVRVGFTRDRADMLVQDIRAAYDHLVAMAGLLNLFGQGLAVDDTAS
TKKPESEHTATALGKMLHGNKSLQEHAEELRRTHDLPGARHLIHMQNWGTIHAKEGTKDA
EPRRSPVDRHQRHKKRSGAVC
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgcctctacacaagacgaacgttgaaaaaggcggtgcgaagcgttttcagcatatcgac
acaagctcgctggctttcgagaccggctttgcaagcttcgcgctcgaggagttccccaag
taccagttgcgagccgagccgatgccgtcggctgttgccgaaggtatcattacgcaggag
ctggagctagacggtaaccctgcactaaacctggcatcctttgtgacgacgcgctttgat
gaaacgacgcacaagctctgtgatcgcatgcttccggtgaactggatcgactttgacgag
tatccgcaaaccgtggagatccacaaccgctgcgtcaatatcatagcgaacctttttcat
gctcctctcgaggagggtcagcaggctgttggcaccagcactgtaggctcctctgaggcg
atcatgctggcggtgctcgcgatgaagtggcgttggcgagcagctcgcaaggcagccggc
aaggactacgcacgcccgaacatggtgatgggttcagaagtgcaggtctgctgggagaaa
gcgactgcttactttgatgtggaaccacgctacgtaccattgcacgacgatgtatacgtc
atgaatccggaaaaagctatagagctttgtgatgagaacaccatcggaatttgcggcatt
ctaggtaccacctacaccggacaatttgaagacattgccactttggacgctctcgtgacg
cagatgaacgagcagaagggttttgatatcggtatccatgtagacgcagcatcaggaggc
ttcatagccccgttttgttaccccaatctcaggtgggactttcgtttgaagaacgtgcgt
tctatcaatgtttcggggcacaagtacggtctcgcgccctgtggcatcggatggctcatt
tttcgcagcgctgcgtatctgccggaggagctcgtctttcacgtcaattacctgggcgcg
gaccaagcctcattcaccttgaacttttcacgcggttccgctcagattgtggcgtcatac
tatttgctgttgcgcttaggccgtcggggataccagaatctaatgcacaccctgaaagaa
ttggcttcgtactttgcaacacgtatcacggaggatgggcgtttccgcctgcttagtgac
aacgaaagcctgcccttggttgcgtttgcgatcccagatgaccagcgcacgaaactgggt
tttgatgagtttgccatagcgggagagttacgcaaacgtggatggatcgttcccgcgtat
acgctggcaccgaacctgcagcaccagaaactgctgcgggtggtggtgcgggtcggtttt
acccgcgatcgggcagatatgctggtccaggatattcgggccgcatatgatcatttagtc
gccatggctggactgttgaacctatttggacagggcctggctgtggacgatacggcgtcg
acaaagaaaccggaaagcgagcataccgccaccgccctcggtaagatgctgcacggcaac
aagtcgctacaggaacacgcggaagagctgcggcgaacgcacgatttaccgggagcccgc
cacctcattcatatgcaaaattggggaaccattcatgcgaaagagggcaccaaggatgcg
gaaccgcgtcgctcgcctgtggaccgccaccaacggcacaagaaacgcagcggtgctgta
tgctga

DBGET integrated database retrieval system