KEGG   Cyanidioschyzon merolae: CYME_CMF072CHelp
Entry
CYME_CMF072C      CDS       T00175                                 

Definition
glutamate decarboxylase
Orthology
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
cme  Cyanidioschyzon merolae
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cme00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CYME_CMF072C
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CYME_CMF072C
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CYME_CMF072C
   00430 Taurine and hypotaurine metabolism
    CYME_CMF072C
Enzymes [BR:cme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CYME_CMF072C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(join(187545..188540,188626..189315))
Genome map
AA seq 561 aa AA seqDB search
MPLHKTNVEKGGAKRFQHIDTSSLAFETGFASFALEEFPKYQLRAEPMPSAVAEGIITQE
LELDGNPALNLASFVTTRFDETTHKLCDRMLPVNWIDFDEYPQTVEIHNRCVNIIANLFH
APLEEGQQAVGTSTVGSSEAIMLAVLAMKWRWRAARKAAGKDYARPNMVMGSEVQVCWEK
ATAYFDVEPRYVPLHDDVYVMNPEKAIELCDENTIGICGILGTTYTGQFEDIATLDALVT
QMNEQKGFDIGIHVDAASGGFIAPFCYPNLRWDFRLKNVRSINVSGHKYGLAPCGIGWLI
FRSAAYLPEELVFHVNYLGADQASFTLNFSRGSAQIVASYYLLLRLGRRGYQNLMHTLKE
LASYFATRITEDGRFRLLSDNESLPLVAFAIPDDQRTKLGFDEFAIAGELRKRGWIVPAY
TLAPNLQHQKLLRVVVRVGFTRDRADMLVQDIRAAYDHLVAMAGLLNLFGQGLAVDDTAS
TKKPESEHTATALGKMLHGNKSLQEHAEELRRTHDLPGARHLIHMQNWGTIHAKEGTKDA
EPRRSPVDRHQRHKKRSGAVC
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgcctctacacaagacgaacgttgaaaaaggcggtgcgaagcgttttcagcatatcgac
acaagctcgctggctttcgagaccggctttgcaagcttcgcgctcgaggagttccccaag
taccagttgcgagccgagccgatgccgtcggctgttgccgaaggtatcattacgcaggag
ctggagctagacggtaaccctgcactaaacctggcatcctttgtgacgacgcgctttgat
gaaacgacgcacaagctctgtgatcgcatgcttccggtgaactggatcgactttgacgag
tatccgcaaaccgtggagatccacaaccgctgcgtcaatatcatagcgaacctttttcat
gctcctctcgaggagggtcagcaggctgttggcaccagcactgtaggctcctctgaggcg
atcatgctggcggtgctcgcgatgaagtggcgttggcgagcagctcgcaaggcagccggc
aaggactacgcacgcccgaacatggtgatgggttcagaagtgcaggtctgctgggagaaa
gcgactgcttactttgatgtggaaccacgctacgtaccattgcacgacgatgtatacgtc
atgaatccggaaaaagctatagagctttgtgatgagaacaccatcggaatttgcggcatt
ctaggtaccacctacaccggacaatttgaagacattgccactttggacgctctcgtgacg
cagatgaacgagcagaagggttttgatatcggtatccatgtagacgcagcatcaggaggc
ttcatagccccgttttgttaccccaatctcaggtgggactttcgtttgaagaacgtgcgt
tctatcaatgtttcggggcacaagtacggtctcgcgccctgtggcatcggatggctcatt
tttcgcagcgctgcgtatctgccggaggagctcgtctttcacgtcaattacctgggcgcg
gaccaagcctcattcaccttgaacttttcacgcggttccgctcagattgtggcgtcatac
tatttgctgttgcgcttaggccgtcggggataccagaatctaatgcacaccctgaaagaa
ttggcttcgtactttgcaacacgtatcacggaggatgggcgtttccgcctgcttagtgac
aacgaaagcctgcccttggttgcgtttgcgatcccagatgaccagcgcacgaaactgggt
tttgatgagtttgccatagcgggagagttacgcaaacgtggatggatcgttcccgcgtat
acgctggcaccgaacctgcagcaccagaaactgctgcgggtggtggtgcgggtcggtttt
acccgcgatcgggcagatatgctggtccaggatattcgggccgcatatgatcatttagtc
gccatggctggactgttgaacctatttggacagggcctggctgtggacgatacggcgtcg
acaaagaaaccggaaagcgagcataccgccaccgccctcggtaagatgctgcacggcaac
aagtcgctacaggaacacgcggaagagctgcggcgaacgcacgatttaccgggagcccgc
cacctcattcatatgcaaaattggggaaccattcatgcgaaagagggcaccaaggatgcg
gaaccgcgtcgctcgcctgtggaccgccaccaacggcacaagaaacgcagcggtgctgta
tgctga

DBGET integrated database retrieval system