KEGG   Cyanidioschyzon merolae: CYME_CMI123CHelp
Entry
CYME_CMI123C      CDS       T00175                                 

Definition
probable ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cme  Cyanidioschyzon merolae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cme00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CYME_CMI123C
Enzymes [BR:cme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CYME_CMI123C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:346230..347444
Genome map
AA seq 404 aa AA seqDB search
MVGNQEKEVERDLVPCSVLVVGSSNTDYVLSGLNRLPQLGETVLVQGANVSFRTAAGGKS
ANAAVAASRFFAGEAQGSVSLITSVGEDENGRNALQNYEREGIFAALSKRSPSEASGIAL
ILLLSSGENAILVAPGANANLRPMDFEATAVDGHGEARLAELRAASVVLMQLEIPYETVR
WVADALYAPPLPRQGPVLIVNLAPMGCELTEPMLQELFFYGPIIVVNEVECGQLLRILWA
NSTEVLEETLETAAHDDWRTCLTGLMERAPALAAIILTRGAAGACAVHRFGTASGTGSTL
QWIQVAAVLSVGSASVVDTTGAGDCFCGYLAAALAQILYRRSAHASRHAESATASRNLSL
DDADFSRALRYATAAATLSVTRKGAQESYPMRQEVERFLRLWKD
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggttggtaaccaagagaaagaagttgaacgagacctcgttccatgtagcgtcctggtg
gttggttcatcaaacaccgactatgtgttatcgggactgaatcggcttcctcagctcgga
gaaacggtgcttgtacaaggagctaacgtaagtttccgaaccgcggccggaggaaagtcg
gcgaacgccgctgtcgctgcgagccggttctttgcaggtgaagctcagggctccgtcagc
ctcatcaccagtgtaggcgaggacgagaacggtcgcaacgccctgcagaactatgagcgc
gaaggcatctttgcggctctgagtaagcgctctcctagtgaggcttccggaatagcgctc
attctcttattgagctccggcgagaacgctattctcgtggctcctggggcgaacgcgaac
cttcgaccgatggactttgaagccacagcagtggacgggcacggagaggcacgcctcgca
gaactacgcgctgcttcagtcgtcttgatgcagttggaaataccctatgaaaccgttcga
tgggtggcggatgcgttgtatgcaccaccgcttccccgacaagggccagtgctgatcgtg
aacctggcgccgatgggatgcgagttaacagagccaatgctccaggagctcttcttctat
ggccctattatcgttgtgaatgaagtagaatgtggccagttgctgcgtatcctttgggca
aacagtacggaggtactggaagaaacgctggaaactgcagcgcacgacgactggcgaacg
tgcctgacgggcttgatggagcgcgcacccgcgttggctgccataatcctcactcggggt
gctgccggcgcctgtgcagtgcaccgtttcgggacggcgtctggaactgggtcgacactt
cagtggattcaggtggcggcagtactaagcgttggttctgcatcagtcgtcgataccact
ggggcaggtgattgtttctgtggatatttggcagcagcgctggcgcaaatcctctacaga
cgctcagctcatgcctcgcgccatgcagagtcggcaactgcttcgcggaacttgagttta
gatgatgctgatttttcgagagcgctgcgctacgcaacagcagcagcgacgctatctgtg
actcgaaaaggcgcacaggagagctaccccatgcgacaagaggtagagcgatttctgcgg
ctctggaaagactga

DBGET integrated database retrieval system