KEGG   Cyanidioschyzon merolae: CYME_CMI128CHelp
Entry
CYME_CMI128C      CDS       T00175                                 

Definition
hypothetical protein
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
cme  Cyanidioschyzon merolae
Brite
Enzymes [BR:cme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CYME_CMI128C
Peptidases [BR:cme01002]
 Cysteine Peptidases
  Family C86
   CYME_CMI128C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:complement(359617..360240)
Genome map
AA seq 207 aa AA seqDB search
MQSSRKSVTSNGVKDSYQSSSAMTASEVQVQPPAFLEKQRWYQCGLHAVNNLLQRPVYAV
EDFEAIARGVSAIVPGIRHKACLGLGCYGAEVVCAAVARQGLCVDTLNCKNTDVALRRLS
GPNVVGLLLNEVESDRRWWQLWRSQRHWLAAVRRATETNSSAYWWIIDSQNCNGRPQKPL
DTRALVSYIVQDMVECVVFIVERRNEL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcagccgtaaaagtgtgacctcgaatggagtgaaagattcgtaccagtcatcc
tctgcgatgacagcgtcggaggttcaggtgcagccgccggcgtttctggagaaacagcga
tggtaccagtgtggtctacacgccgtaaacaacttgcttcaaaggccggtatatgctgtg
gaagacttcgaagcgatcgcgagaggagtttcggcgatagtgccgggtatacgacataag
gcgtgtctcgggctcgggtgctatggtgccgaagttgtttgcgctgcggttgcgcgccag
ggtctctgcgtcgataccctcaactgtaaaaacaccgatgtagcgttgcggcgcctgagt
ggccccaatgtggttggtttgctcctcaatgaagtggaatcggaccgacggtggtggcag
ctatggcgctcgcagaggcactggctggcagcggttcgtcgtgctacagagaccaacagt
tcagcgtattggtggatcatcgattcgcagaactgtaacgggcgtccgcaaaagcccctg
gatacgagggccctcgtctcctacatagtgcaggatatggtggaatgcgttgttttcatc
gtcgaacgacgaaatgaattgtaa

DBGET integrated database retrieval system