KEGG   Cyanidioschyzon merolae: CYME_CMJ087CHelp
Entry
CYME_CMJ087C      CDS       T00175                                 

Definition
probable beta-amylase
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
cme  Cyanidioschyzon merolae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cme00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CYME_CMJ087C
Enzymes [BR:cme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     CYME_CMJ087C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:complement(268909..270453)
Genome map
AA seq 514 aa AA seqDB search
MQRTWNILRSFSRVVDSVPIYVMLPLEFPTMDENDCRRLVEQTIPHVAGASKCAGFMVDL
WWGLCEQEPRKYTWCEDRYRALFSMCQRLGVKCQVVLGFHKCGGNVGDSVTYGLPEWVLA
RARELKEKENKVILYMDRHGYMSEEYISCGADEEPLFPVQSAAANSEQQAASGQDASSPA
TDAQASAETEAPAASAQVEMRSPLQCYEEFMNAFVKDFGDEFFGTVIHEVHIGMGPASEL
RYPSYPLTDGKWKFPGIGEFQCYDTFLMKDLEKALANQKFSEDEIRKCIPPRDTAGSYCD
TPDQSEFFRSLYATPAGRFFLKWYGSKLLEHGERVLVVANKCFHSYIADRRVRLGIKVAG
IHWWFKTPSHAAEMTAGYYHTADDPWTMYDGIAALLRKHGIIWNFTCYEMRDSEQREGKC
SPEGLVNRVRIAAQKHGVALAAENALPRYDRKAYKQIVAQAKPSSWGISLPFGRKAETRK
TLCGFTYLRLTPELLEKHHLREFANFVSWMQGAK
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaacctggaacatccttcgatctttcagtcgcgttgtcgacagcgtgcccatc
tacgtgatgcttccgttggagttcccgaccatggatgagaacgattgtcgccgtctagtc
gagcagacgatcccgcacgtggctggcgccagtaagtgcgccgggttcatggtggatctc
tggtggggtctttgtgaacaggagccgcggaagtacacctggtgcgaggatcgctatcga
gcgctgttttccatgtgccagcgactgggcgtcaagtgtcaagtggtgctgggctttcac
aagtgcggcgggaacgtcggcgactccgttacctacgggttacccgaatgggtgctggca
cgtgcccgtgaactaaaagagaaagagaataaagtgatcttgtacatggatcggcacggc
tacatgagcgaggagtacatatcgtgtggggccgacgaggaaccgcttttcccagtacag
agcgccgctgcgaactcggagcagcaggccgcatctgggcaagatgcgtcttcaccagcg
acggacgcacaggcttcggctgaaaccgaagcaccagcggccagcgcacaagtggagatg
cgctccccgcttcaatgttacgaggagtttatgaatgctttcgtgaaagactttggagac
gaatttttcggtacagtgattcacgaggtgcacattggcatgggtcccgccagcgaacta
cgttatccatcgtatccgctcactgacgggaagtggaaattccccggaatcggcgagttc
cagtgttatgatacttttctgatgaaagatctggagaaagcgctcgcaaaccagaagttt
tccgaggatgagattcgcaaatgcatcccaccacgcgataccgccggatcgtattgcgac
actccggatcagtcggagtttttccgctcattgtatgccacaccggctggccgcttcttt
ctcaagtggtacggaagcaagctactggaacatggtgagcgtgttttagtcgttgccaac
aaatgcttccattcgtacattgcagatcggcgcgtccgcctggggatcaaagtcgccggt
atccattggtggttcaaaacgccaagccacgcggccgagatgacggctggctattatcac
accgccgatgacccctggaccatgtacgatgggattgcagcactgctgcgcaaacatggc
atcatctggaatttcacctgctacgagatgcgcgatagcgagcagcgtgagggaaaatgc
agtcccgagggcctcgtcaatcgcgtccgcatcgctgcccagaagcacggcgttgcgctc
gcggctgagaatgcgctcccgcgttacgatcgcaaagcgtacaagcagatcgtcgctcaa
gcgaaaccatcctcctggggcatatccttaccttttggccgcaaggcggagacgagaaag
acgctctgcggctttacgtatttgcgcctcacacccgaactgctggaaaagcaccatctg
cgcgaatttgcaaattttgtcagctggatgcaaggagctaaatag

DBGET integrated database retrieval system