KEGG   Cyanidioschyzon merolae: CYME_CML102CHelp
Entry
CYME_CML102C      CDS       T00175                                 

Definition
histone acetyltransferase HAC108/MYST
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
cme  Cyanidioschyzon merolae
Brite
Enzymes [BR:cme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CYME_CML102C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12:228878..230689
Genome map
AA seq 603 aa AA seqDB search
MPLGRTRSESSPNSLVTENETVGNQPEGNRGGVARVTRRALRRSATAGVATNSTGTAESA
NALSECSIPGETSFEHGTLREPGQRSSDSSLERATPTAASDLELASDTSDESALRRERSE
RHRIQRSHAVSSSLVATEYDAVGGKAGNTPRSTLSPQASASSVSDEALDADLSKHVDLGR
IPLPRNLQLIAQSQILHEPHLGSIVDVRYNDELQQHEYYIHFDGWNKRLDEWLTIEHFDL
SDLSERLREHYRRERASQARRRSRSSATASSGKRLRKAEHATAADVASSTAAAAAAAALG
NESRADQQQKAASGTSAGADLPADVVTRVKNLHSIVIGRWEMETWYYSPLPPEYRNLRTL
YVCEFTLKFFRTRDGLERHLARNTRWCPPGREIYRKDHLAVFEVDGARNHFYCQNICYIS
KLFLDHKTLYYDVDPFLFYVLCEIDDWGYHFVGYFSKEKASEENYNVACILTLPPYQRKG
YGKFLIALSYELSRREGIRGSPEKPLSDLGLLGYRSYWSQILIDLLMKATGPLSIEDIAD
RTMMKTEDIIGTLRALDLVHYHEGQHVIDLRRVEHMDLGNRGMPFDPQYLRWSPPVERKR
RKS
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgcctctagggcgcactcgctcggaatcgagtccaaactcgttggtcacagagaacgaa
accgttggaaaccagccagagggaaaccgaggcggcgtagccagggtcacgaggcgagcg
ctgcgtcgtagtgcaacggccggcgttgcgaccaactcgaccgggactgccgagtctgca
aacgcactcagcgagtgcagcataccaggcgaaacgagcttcgagcacgggacgctgcgt
gaacctggtcagcggtcaagcgactccagcctggagcgtgcgacgcccaccgcagccagt
gaccttgagctcgcctcggatacgtctgacgagagcgcacttcgccgagagcgctccgaa
cgacatcggatacaacgaagtcatgccgtttcttcttctctagtggctactgaatacgac
gcagtgggtggcaaggccggaaacacaccacgttcaaccctgtcgcctcaggcgagtgcg
tcgagcgtcagcgacgaggctctggacgccgacctgagtaagcacgtggacctgggtcga
attccgctgccgcgaaacttgcagctcatagcgcagtcacaaatactgcatgagccgcac
ctgggctccatcgtcgacgtgcgctataatgatgaacttcagcagcatgaatactacatc
catttcgatggatggaataaacggctggatgaatggctaacgatcgagcatttcgacctt
tcggatttgtcagagcgtctcagggagcattatcgtcgcgagcgagcatcccaggcgagg
cgccgctcgcgttctagcgctacggcgagcagtggcaaacgtttgcgcaaagcggagcat
gccaccgccgccgacgttgcttcttccactgctgctgctgctgctgctgccgctttgggt
aacgagtctcgtgcagatcaacaacaaaaggctgcttcaggcactagtgctggcgcagac
ctgcctgcggatgtggtcactcgggtgaaaaacctccacagcatcgtcatcggacgctgg
gagatggagacctggtactattcgcctcttccaccagaataccgcaatttgcgaacactc
tacgtgtgcgaattcacactcaaattcttccgtacccgagatgggcttgagcgacatctc
gcacgaaacacgcgatggtgcccacctggacgggagatctatcgcaaggaccatctcgcg
gtcttcgaggtcgatggcgcccggaatcatttctactgccagaacatctgctacatatcc
aagctgttcctggaccacaagaccctctactacgacgtggatccgttcctgttctacgta
ctatgtgagattgatgattggggataccactttgtcggctatttctccaaagaaaaggcc
agcgaggagaactacaacgttgcctgcattctcacgttgccaccctaccagcgcaaaggg
tacggcaaattcctcattgcgctcagctatgaactgagtcgacgcgagggtatccgtggt
tcgcccgagaaaccgctcagcgacctcggattgctcggctaccgcagctactggagtcag
atcctcattgatctactgatgaaagcgactggtccgctgagcatagaggatattgccgat
cgcacaatgatgaaaaccgaagatatcattggcacactccgagcactggatctcgtgcac
taccacgagggccaacacgtcatcgatttgaggcgtgtcgagcacatggatctcggtaac
cgtggtatgcccttcgatcctcagtatcttcgttggtcgccaccagtcgagcgcaagcgg
cgcaaatcatga

DBGET integrated database retrieval system