KEGG   Cyanidioschyzon merolae: CYME_CMM045CHelp
Entry
CYME_CMM045C      CDS       T00175                                 

Definition
stearoyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cme  Cyanidioschyzon merolae
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cme01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:cme01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13:complement(96361..97791)
Genome map
AA seq 476 aa AA seqDB search
MTAKVESKVREEEKGSNPSTAAADDSGAVIPTLKPRPKPAVEPLEREGVEFDPQRGLVFE
KTRSSKWMSEKELNELPLLQRINWLSTSIIFTPLIGTLIGIWFVPLQRKTLVLAIVTYFC
CGLGITGGYHRLWSHRSYEAHWLVQVILACFGAAAFEGSARYWCRLHRAHHRYVDSDRDP
YAVEKGFWYAHLWWMVFKLPRQRQGRVDITDLNANPILRFQHRYYLQIAILFSFVIPLTI
STLGWGDFWGGLVYACLGRMLFVQQSTFCVNSLAHWWGEQTFSRRHTSYDSVITALVTLG
EGYHNFHHEFPHDYRNGVVWYHWDPTKWVIRLLSWAGLAWHLVRFPRNELVKARLQVRQE
ILDEAKKRVDWGKPIESLPVWTWKDVQRLAKEENRLLVVIEGIVHDCTRFKVQHPGGQRI
LEFWNVRDATQAFNGDVYNHTKAARNLLAHLRVAQLKEIYEPECDESTTEMSTKSS
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgacagccaaggttgaatcaaaagttcgtgaagaggaaaagggcagcaatccgtccaca
gccgccgcggacgacagcggtgcggttatcccaacgctgaaaccgcgtccgaaaccggct
gtggagccgctggagcgagagggtgttgagtttgacccacaacgtggccttgtattcgag
aagacgcggagttcgaagtggatgagcgagaaggaactgaacgaactgccgcttctacag
cgcatcaactggctctcgacgagcatcatcttcacgccgctcattggaacgctgattggg
atctggttcgtgcctcttcagcggaaaacgctcgtactcgcgatagtgacctatttctgt
tgcggacttggcattaccggcgggtatcatcgcttgtggagccaccgctcctacgaggcg
cactggctcgtacaagtcattctggcgtgtttcggagcggcggcgtttgagggtagtgcc
cgctactggtgccgtctacaccgcgcgcaccaccgctatgttgactcggaccgcgacccg
tacgcggttgagaagggattctggtacgcgcacttgtggtggatggtcttcaagctacca
cggcagcgccagggccgtgtcgacattaccgatttgaacgccaacccgatcctgcggttc
cagcatcgctactacctgcagattgcgattctcttctcgtttgtgatcccgttgacgata
tctacgctaggatggggagacttctggggtggccttgtgtacgcttgtctcgggcggatg
ctgtttgtccagcaatcaacattctgcgtcaattccctcgcgcactggtggggtgagcaa
accttctcacgccggcataccagctacgactcggttatcaccgcactggtcacactaggc
gagggctaccacaatttccaccatgaattcccgcatgactatcgcaatggcgtggtgtgg
tatcactgggaccctaccaagtgggtaatccggctcctatcatgggctggactcgcgtgg
catttggttcggttcccgcgtaatgaactcgtgaaggcgcgcctacaggtgcgtcaggaa
atactggacgaggccaaaaagcgggtcgattggggcaagcccattgaaagtctgccggtg
tggacttggaaggatgtgcaacgcctagcgaaggaggagaaccgtctcctcgtcgtgatc
gagggtatcgtacacgactgtacgcggttcaaagtccagcaccctggcgggcagcgcatt
cttgagttttggaacgtccgggacgcaacgcaagcgttcaacggggacgtttacaaccac
accaaggctgcgcgcaatctgctcgcacatttacgcgttgcgcagttgaaagagatctac
gagcctgagtgcgacgagagcacgaccgagatgtcaacaaagtcttcgtga

DBGET integrated database retrieval system