KEGG   Cyanidioschyzon merolae: CYME_CMM094CHelp
Entry
CYME_CMM094C      CDS       T00175                                 

Definition
elongator protein Elp3p
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
cme  Cyanidioschyzon merolae
Brite
Enzymes [BR:cme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CYME_CMM094C
Transfer RNA biogenesis [BR:cme03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    CYME_CMM094C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13:216036..217784
Genome map
AA seq 582 aa AA seqDB search
MSTSQVIDYIIRKLIEAYENDEAVSLDRLKLEAAKHFGVNGVPKLMDIVAAVPDEYRDVL
VPQLRVKPVRSSSGIIIVAVMSKPHRCPHIYTTGSVCIYCPGGPDSSFPYSAQSYTGLEP
TSMRAIRARYDPYLQVRSRIDQLQSLGHAADKVEFIIQGGTFMSLPADYRDWFIRNLHDA
LSGHASMSVAEAVRYGEQSARYKCIGLTIETRPDFCQRTHLDAMLQYGCTRLEIGVQSVY
EDIARLTNRGHTVEAVIRCFQLAKDAGYKVVAHLMPNLPDMDRERDVECFREFFENPAFR
ADGLKIYPTLILANTGLYELWRAGKYRSMPPPELVDHVAELLSLVPPWVRVYRVQRDIPM
PLVTSGVQFGNLRELVLARMRDLGLRCRDVRTREVGIREIHEAVRPQSIELVRRDYVANG
SWETFLAYEDPVRDILVALLRLRRLSKETTHRMELRIEDTAAGDDSSNSGVGQGTGCSVV
RELHVYGTVVPVHERDPTRFQHRGFGTLLMEEAERIAREEHRSCKLAVISGIGTRNYYRK
LGYTLEGPYMVKYLAAGTAKVSPSGMSSCMGEQIRADMAVSV
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaagtcaagtcatcgactacatcattcgcaagctcattgaagcctacgaaaac
gacgaggccgtttcgctggatcggttaaaactagaagctgcaaagcatttcggtgttaat
ggagtaccaaagctcatggacatagtggctgctgtgccagacgaataccgcgacgtactc
gttccacagctgcgcgtcaagccggtacgctcgtcgtcgggaatcatcatcgttgccgtg
atgtcgaagccgcaccgttgccctcacatctacacgaccggcagcgtctgtatttactgt
ccagggggtcccgactcgtctttcccgtactctgctcagtcctatactgggttagagccg
acgagtatgcgagcgattagggcgcgttacgatccctaccttcaggtacgctctaggatc
gatcagttgcaatcgcttggtcacgcagctgacaaagtggagtttatcattcaaggcggt
acgttcatgagtttgcctgcagactaccgggattggtttattcgtaaccttcacgacgcg
ctctcgggacacgcgtccatgagtgttgccgaggcggtccgctacggcgagcagagcgcc
agatacaagtgcatagggctcaccatagagactcgtccagacttttgccaacgaacacat
ctagacgcgatgctgcaatacggttgcacccgtctagaaataggggtgcagagcgtctac
gaggatatcgcgagactgaccaatcggggtcacacggttgaggccgtcattcgctgcttc
cagctcgccaaggatgccggttacaaagttgtcgcccacctgatgccaaacctcccggat
atggatcgagagcgtgatgtcgagtgcttccgggagttcttcgagaacccggcctttcgc
gccgatggtctgaaaatatatccgacgctgatcctggcaaacacgggcctctatgagctg
tggcgagcgggaaaatatcgcagtatgccacctcctgagcttgttgatcacgttgcggag
ctcttgtctctagtaccaccatgggtacgagtctaccgcgtccagcgtgatattccgatg
ccgctggtcaccagcggtgtacagtttggcaaccttcgggaactggtgttagcacgaatg
cgcgacctgggactacgttgtcgagacgtgcggactcgtgaagttggtatccgggaaatc
catgaagcagttcgaccgcaatctattgaacttgttcggcgcgattatgtggcgaatggt
agctgggagaccttcttggcctacgaagatccggtacgggatattttggtagcactgctt
cgactgcggcgcctcagcaaagagacaacgcatcggatggaactgcgtattgaagacaca
gctgccggggatgattcgagcaatagtggcgttgggcaaggcaccggttgctctgtggtg
cgcgagctccacgtctacgggacagtggtgcccgttcacgaacgagacccgactcgattt
cagcatcggggcttcggtacgctcctcatggaagaagcggagcggatcgctcgcgaagag
catcgcagctgcaagctcgcggttatctctggcattggcactcgaaactattatcgcaaa
ctgggttacacactcgaagggccctatatggtgaagtacttggcagcgggtactgcgaag
gtctcgcccagcggtatgtccagttgtatgggcgaacagatacgcgcagatatggctgtt
tccgtgtag

DBGET integrated database retrieval system