KEGG   Cyanidioschyzon merolae: CYME_CMM136CHelp
Entry
CYME_CMM136C      CDS       T00175                                 

Definition
NAD-dependent deacetylase sirtuin 6
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
cme  Cyanidioschyzon merolae
Brite
Enzymes [BR:cme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     CYME_CMM136C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13:complement(310577..312271)
Genome map
AA seq 564 aa AA seqDB search
MAHDYAGRLRPYENKGRLGLAPDWDRLLDVQRKVQVLAQWLRAACGDVVVHTGAGVSTAA
GVRDFRGPHGVWSEATRSKNGRSRPGVAPGAAQQHEPLTRDGARCADVIDPRTQPPPPDC
SLELAAPTWSHWALTELVRRGLVRRIVTQNIDGLHLRSGLARHRLSELHGNIFAEQCERC
GQIFLNDVVVPTVGGRRTGHQCVYCAWRGQRASTRDMLLDWEDPLPQADLMGATEDSRNA
RLCLVMGSSLQMVPAATLPALCLRKDGARLVIVNASWTARDDAAHLVIRAPTDMVMLLLL
DELALLPPGDARVRLWRPQLTLGVRWRQRPRQSRPSVDVCVWNGNGNAPGLTLDHTLHGA
CKREPSKHNSSCADTPLYWIPLHGRMIADANQVPALEALELDASGHLSLTVAGFGQRSCA
EPPFCTAAAVSIRLGFPLAPRGTSQPPLVVPNVWYFLSIPRAGWLEFNVVAYRAYVVRLL
ASEWVQSERIQLPPALLFYREDDRRRCSCIVCGASVPPQKRTHHVQCVHAEALGQRAASA
PDLERQRNDLQGRRSEKRARLPRV
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgactacgccggacgtttgcgcccgtatgaaaacaagggacgcctcgggctc
gcgcccgactgggatcgcctgctcgacgtgcaacgaaaggtacaagtgctggcccagtgg
ttgcgcgcagcgtgcggcgacgttgttgtccacacgggcgcgggtgtatccacggcagct
ggggtgcgcgactttcgtggaccacacggcgtctggtccgaagcgacgcgctcgaaaaac
ggacgctcgagacctggggttgctccgggtgcggcccagcagcacgagcctctgactcga
gacggggcgcgttgcgcggacgtcatcgacccgcggacgcagccgccgccgccagactgc
agcctagagcttgcagcgccgacctggagccactgggcgctcaccgaactcgtgcgtcgc
ggcttggtgcgacgcattgtcacgcaaaacatcgacggcttgcacctgcgcagtggactc
gctcgtcatcgtctctctgagctgcacgggaacattttcgcagaacagtgtgaacgctgt
ggtcaaattttcctgaatgatgtggttgtgcccacggttggcggtcgccgaaccggtcac
cagtgcgtgtactgtgcatggcggggtcagcgagcatcgacgcgcgatatgctgctcgac
tgggaggatccgctgccgcaagcggatctcatgggcgcgaccgaggactcgcgaaacgcg
cgcttgtgtctggtcatgggctcgagtctgcagatggtaccggcggcgacgctgccagcg
ctctgtctgcggaaggatggcgcgcggcttgtcattgtcaacgcgtcgtggacggcgcgg
gatgatgcggcgcatttggtcattcgcgccccaaccgatatggtgatgctgctcctactg
gatgagctcgcattgctaccgccaggggacgcgcgggtgcgcctctggcggccgcagctg
acgcttggcgtgcggtggcggcagcgcccgaggcagtcgcgcccgagcgtggatgtctgt
gtttggaacggaaacggcaatgcgcctggattgacgctcgatcacaccttgcatggtgcg
tgcaagcgcgagcccagcaagcacaacagcagctgcgcggatacgccgctctattggatt
ccgttgcatggtcgaatgatagctgacgcgaatcaagtaccggcgctggaggcgctggaa
ctggatgccagcggtcatctatcgttgactgtggccggctttggtcagcgaagctgtgca
gagcccccgttttgcacagcagcggcggtttcgatacggttgggatttccgctagccccg
cgcggcacgtctcaaccgccactggtcgtaccgaatgtctggtatttcttgtcgataccg
cgtgccggttggcttgagttcaatgtggtcgcttaccgggcgtacgttgttcgtttgctt
gcatccgagtgggtgcaaagcgaacgcatccaactgccgcccgcgctgctgttctatcgc
gaggatgatcggcgtcgttgttcctgtatcgtgtgcggagcatcggtgcctccgcagaag
cgaacgcatcacgtgcagtgtgtgcacgccgaggccttggggcagcgcgcagcctctgct
cccgacctagagcgacagcgcaacgacttgcaaggcaggcgcagcgagaagcgagcgcga
ttgccgcgtgtttaa

DBGET integrated database retrieval system