KEGG   Cyanidioschyzon merolae: CYME_CMM151CHelp
Entry
CYME_CMM151C      CDS       T00175                                 

Definition
(RefSeq) probable histone acetyltransferase GCN5
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cme  Cyanidioschyzon merolae
Brite
Enzymes [BR:cme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CYME_CMM151C
Transcription machinery [BR:cme03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CYME_CMM151C
Chromosome [BR:cme03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    CYME_CMM151C
   HAT complexes
    PCAF complex
     CYME_CMM151C
    STAGA complex
     CYME_CMM151C
    TFTC complex
     CYME_CMM151C
    SAGA complex
     CYME_CMM151C
    SLIK complex
     CYME_CMM151C
    ADA-HAT complex
     CYME_CMM151C
    HAT-A2 complex
     CYME_CMM151C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13:349617..350984
Genome map
AA seq 455 aa AA seqDB search
MPSKRKQPTAKQTVKTEPAGSSQVSASFKAEPESKTPPPEEEEEDFRVEPSCEVPRARNP
IQPDYPGAYTMSSEDIIGTDSHLAYVSRWHRMREEERRGSVCFRVVTNDGSRPALVQLLG
LKNVFVRQLPNMPRPYVVRLVFDRKHESLIMIKKLPSGEEVVMGGCCYRPFSEQRFAEIA
FLAISHSEQVRGYGTRLMAHTKERAKALQLTHLLTCADNNAVAYFKKQGFSKIITLPPER
WQGYIKDYEGIVLMECALNYKVDYLNIPPLLKAQKLCLLEKLREVSRSHIVYPGIDVKKM
KGIRIEDIPGLQHVDLDRVPPPTAAHGTRSGVSSAKPLTAAAAIARERDPVQLAALQKEL
QQVLNQIKSHSSAWPFLEPVDPQETGAYNYYEIIKNPMDLRTIQERLDSGWYYVNRDIFL
ADLNRMVKNAIDYNGPGHYISELALSLKRFYSSKL
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcaaacgaaagcaaccgacagcgaagcaaacggtgaaaaccgaaccagcaggt
agctcgcaggtctctgcaagctttaaggctgagcccgagtcgaagacccctccgcccgaa
gaagaagaagaggattttcgagtggagccctcgtgtgaggttccacgtgcgcggaacccc
atccaacccgactatcccggtgcgtacaccatgtcgtcagaggacatcatcggaaccgac
tcccatcttgcgtacgtttcacgctggcatcgcatgcgcgaggaagagcgccgtggctca
gtttgctttcgagtcgtgacaaacgacggctcccgaccggcgcttgtacagttactaggt
cttaagaatgtgttcgttcggcagctgccgaatatgccgcgaccctacgtcgtgcgcctt
gttttcgatcggaagcacgagtcgctgatcatgatcaaaaaactgccctccggcgaggag
gtggtcatgggtggctgttgctaccgtccgttctccgagcagcgttttgctgagatcgca
tttcttgccatctcccacagcgagcaggtccgcggttacggcacacggctcatggcacat
acaaaggaacgcgcaaaggcgctccaactcacgcatttgctcacctgtgcagataacaac
gccgtggcttattttaagaagcagggctttagtaagatcataacgctaccgcctgaacgt
tggcaaggctatatcaaggactacgaaggcatcgtgctgatggagtgcgctctgaactac
aaggtcgattacttgaacattccgcccttgttgaaagcacaaaaactatgcctcttggag
aagctgcgcgaggtatcccgctcgcatatcgtctacccagggattgatgtgaaaaagatg
aaaggcattcgaatcgaggatatacccgggctgcagcacgtcgacctggatcgagtacca
ccgccaaccgcagcccacgggacccgctctggcgttagcagcgcgaaaccgctcacggct
gctgcagcaatcgctcgggaacgcgacccagtgcagttagcggcactgcagaaggaattg
caacaggttttgaaccagatcaaatcgcactcgagtgcgtggccgtttctggagccggtg
gatccccaggaaaccggtgcgtacaactactacgaaatcattaagaacccaatggatttg
cgtacgattcaagagcgcctggactctggctggtattatgtgaatcgcgatatttttctc
gctgacctgaatcgaatggtgaaaaacgctattgactacaatgggcctggtcattatatc
agcgaattggctctttcgctcaagcgcttctattcgagcaaactttaa

DBGET integrated database retrieval system