KEGG   Cyanidioschyzon merolae: CYME_CMO018CHelp
Entry
CYME_CMO018C      CDS       T00175                                 

Definition
ubiquitin carboxy-terminal hydrolase L5
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
cme  Cyanidioschyzon merolae
Brite
Enzymes [BR:cme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CYME_CMO018C
Peptidases [BR:cme01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   CYME_CMO018C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15:complement(48794..49834)
Genome map
AA seq 346 aa AA seqDB search
MASSVDDGADSEGGWCTIESDPGVFTAMITELGVKGVQVDELVDLSEEAFVAANLACPVF
GLIFLFKYDQVLAAPASEPLSTAETPHHLIFSRQVIRNACATQALLAVLLNARQRGLQLG
PLLTEYAEFAQALDAETRGELLANARDICAVHNSFSPLRGILLEEDPSLRNLLPREDVFH
YVSYVPLGGKVYELDGLQTGPSAVGTFDASLLAPGTPDSKQQLPTAEAQHHNDLAWVCVA
LRAVRQRISRASNQELRFSVLVVHRDPRPELQVRASGGDQVAASLLAQEEAKHARWQLDT
TLRRMDLVPLAIRLLILFADHGHFVELLEEAKRKREQQVANHAEHS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcgagctccgttgatgacggcgctgactcggagggaggctggtgtaccatcgaatcg
gatcctggtgtctttactgccatgataactgaactgggcgtgaaaggtgtccaggtggac
gaactcgtggacctcagtgaagaagcgtttgttgcagccaacctcgcgtgtccggttttc
ggcctcatctttctcttcaagtacgaccaagtattggcagcgccggcgtctgagccgctc
tcgactgccgaaactcctcatcatttaatcttttcgcggcaagtcattcgtaatgcgtgt
gccacccaagctttgcttgcagtgctcttgaacgcacggcaacgaggtctgcaactgggc
ccgcttttgacagagtacgcggagtttgcgcaggcacttgatgcggagacacggggcgag
cttttggccaatgctagggatatttgcgcggttcacaactcattctcccctctgcggggt
attttactggaagaggatccatcccttcgtaacttgcttccgcgcgaagatgtcttccat
tacgtctcctatgtgcctctcggcggcaaggtatacgagttggatggcctgcagactgga
ccgtcggcagtgggcacttttgatgcttcacttttggcgcctggaacgccagactcgaaa
caacagttacccacggccgaagcgcagcatcacaatgatttggcctgggtctgcgtagcg
ttgcgggctgttcggcaacgcatctctcgagcatcgaatcaagaattgcgcttcagtgtc
ttggttgttcatcgggatcctcgtccagagctccaggtccgagcgagcggtggtgatcaa
gttgctgcatccctgttggcccaggaggaggccaagcacgcacgatggcagctggacacc
acgctccgaagaatggacctggtgccgctggcgatccggctgctgattctgttcgctgat
catggacactttgttgagcttctagaggaggccaagcgaaagcgagagcaacaggtcgca
aatcatgccgaacactcataa

DBGET integrated database retrieval system