KEGG   Cyanidioschyzon merolae: CYME_CMO284CHelp
Entry
CYME_CMO284C      CDS       T00175                                 

Definition
probable 3-oxo-5-alpha-steroid 4-dehydrogenase
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
cme  Cyanidioschyzon merolae
Brite
Enzymes [BR:cme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     CYME_CMO284C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15:complement(720210..721088)
Genome map
AA seq 292 aa AA seqDB search
MNLLSDDALLWSWIALAVLVFPVLFLVSAPYGRHLRTGWGPTLRSDLGWIIQESPSFLIM
AVYLTRWLRQRTDKLLKLGFDEREWMTVTLAFCWLVHYANRAFVFPLRMRGGSKPTTFTV
VSTAILFCVINTYLNAKALFVYELVIRSRRSLDWAFCSGLLLWVCGLIGNWHSDAITRAL
RRNPEEIKEKRYAIPYGGLYRYVSAPNYFSEFVEWTGFAIAAQTWAAFSFALWTFSNLYP
RARSNHQWYLENFAEYKSLNRNAFFPNPLKSAAVRARAPQRRGASSHQQKSR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttctttcggatgatgcactattatggagctggattgctctcgccgtacttgtg
tttccagtgcttttcctcgtatcagcaccatacgggcggcatttgcgtaccggctggggc
cctacgctgcgcagcgacctgggctggatcatacaagagagcccctcgttcctgattatg
gccgtgtacctgactcgttggcttcgtcagcgtaccgacaaactcttgaagctcgggttt
gatgaacgggagtggatgactgttacgttggcgttctgttggcttgttcactatgcgaac
cgcgcctttgtgttccctctgcggatgcgtggaggctcgaagcctaccaccttcactgtt
gtttcgacagctatcctgttctgcgtcattaacacctatttaaatgcgaaagcactgttc
gtttacgaattggtcattcgctcgcgtcggtccttggactgggcattctgcagcggctta
ttgctttgggtgtgtggcttgattggcaactggcatagcgacgcgatcacgagagcgttg
cggcgaaaccctgaagagatcaaagagaaacgttacgctattccatatggtggtctgtat
cgctacgtcagcgcgccgaactacttctctgagtttgtggaatggacgggttttgcgatc
gccgcacagacgtgggcagcgttctcattcgcgctttggacgttttcgaacttatacccc
agggcacggagcaaccatcagtggtatttggagaactttgccgagtacaagtcactgaac
cgaaacgcgttcttcccgaacccattgaaatctgcagctgtccgggcgagggcgccgcag
cgacggggtgcgtcttcacaccagcaaaaaagtcgctag

DBGET integrated database retrieval system