KEGG   Cyanidioschyzon merolae: CYME_CMP066CHelp
Entry
CYME_CMP066C      CDS       T00175                                 

Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
cme  Cyanidioschyzon merolae
Brite
Enzymes [BR:cme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     CYME_CMP066C
    1.3.1.94  polyprenol reductase
     CYME_CMP066C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16:complement(169876..170838)
Genome map
AA seq 320 aa AA seqDB search
MICSAVGVSLLVYWACALSLTVGKIWSTRLDAWTRYGGLRHSEDDTLDQRKTQRRWGTLS
RAQTFRAFYLVAFIWNGALLYHTRLANLCRYSARREQVSCSCATAYGWVATLFQVHTLRR
LGESYFIHSFTEQKLPLVLTAAGLSFYVSLPILWVWGRSCCHHHGQCLSDLDLLPALHMR
KQSTIPLTLLLICFSAANFAQFWAHYELARVRKAHKRPRSHYAVHDAVSCSPKYAIVTRG
LFRWSTCPHYLAEILIYGILIGYLVVSGCVGLCAALPGMVMLFVATNLGHTAVLSKECLR
RRYPLVEFVQKRPALVPCLL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatctgcagcgctgtaggtgtcagtcttcttgtgtattgggcgtgtgcgctgtcgctg
acagttggcaaaatctggagtacgcgacttgacgcgtggacccggtatggcggcctacgg
cacagcgaagacgataccctggaccaacggaaaacgcaaaggcgttggggcacgctttct
cgtgcgcagactttccgcgcattttacttggtagccttcatctggaacggcgctttgctc
taccacacacgacttgcgaacctctgtcgatatagtgcgcgaagagaacaggtcagctgt
agctgcgcaactgcgtatggttgggtagcgaccctgttccaagtgcacaccctgcgacgt
ctcggtgagagctattttatccatagcttcaccgaacaaaaacttccgctcgtccttact
gccgccgggctatctttttacgtatctctgccgatactctgggtgtggggtcggagctgc
tgtcatcatcatggccagtgcctgagtgatctagatctgctgccggcgctgcacatgcgg
aagcaaagcacaataccgctcacgttgcttctcatctgtttcagtgccgccaactttgcg
caattctgggcacactacgagcttgctcgagttcgcaaggcgcacaagcgcccacgctct
cactacgctgtacacgacgctgtgtcgtgttctccgaagtacgcgattgtgacgcggggg
ttatttcgctggagtacgtgcccccattatctcgctgaaatactgatctatggcattctg
atcggctatctggtcgtttcggggtgcgtggggctatgcgccgccctgcctggcatggtg
atgcttttcgtggccaccaatctgggccatacagcggtgctcagcaaggaatgcctcagg
cgacgttatccgctcgtggaatttgttcagaaacgtccagcgctggtcccgtgtctcctc
tga

DBGET integrated database retrieval system