KEGG   Cyanidioschyzon merolae: CYME_CMP170CHelp
Entry
CYME_CMP170C      CDS       T00175                                 

Definition
similar to formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cme  Cyanidioschyzon merolae
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:cme00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    CYME_CMP170C
Enzymes [BR:cme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     CYME_CMP170C
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     CYME_CMP170C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16:433407..434189
Genome map
AA seq 260 aa AA seqDB search
MPELPAVERARRMIDALCKSYRRINVQSAPDPKHASEFVDKLFEGRLGLDLLERRVCVGH
VLRQLGRHGKNLWFEFDEPPHVFVRFRMAGSFVVRGHEDGYVYETFRRRTAACRFHDSGT
PLVSVWPPKHTHIVFSFAPCSPGVDSASINGISVREFALVDPRKVTRMRLSDSSCPSVEI
RSLIGGFDALHALPPIERFERKMLVYPKANIKSLLLGQRFIAGLDNWMVDEVLYYAHIHP
ESRTCDLTRIDVAALHQSIA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgccagagctgccagcagttgagcgggctcgtcgtatgatcgatgccttatgtaagagc
tatagacggataaacgttcaatccgcacccgatccgaaacatgcctctgagtttgtggac
aagcttttcgaaggcaggctggggctggacctgctcgagcgacgtgtctgcgtaggtcat
gtgctgcggcaacttggccgtcacggcaagaacctgtggtttgagttcgacgaacctccc
cacgttttcgtccgctttcgaatggctggctctttcgtggttcgtggtcacgaagacggc
tacgtttatgagacttttcgccgacgtactgccgcctgtcggttccacgactcaggaacg
cccctcgtctcagtctggccaccgaagcatacacacattgtttttagttttgctccctgc
tccccaggagtagattctgccagtataaacggtatctctgtccgagagttcgcgctggtc
gacccgcgaaaggttacgaggatgcgcctcagcgactcgtcgtgtccttctgtcgagatt
cgaagcctcataggaggcttcgatgcgctgcatgcgctccctcctattgagcgcttcgaa
aggaaaatgttagtgtacccgaaagcgaatatcaaatcgttgcttttgggccagcgcttc
atcgctgggctcgacaattggatggtcgacgaagttctttattacgctcatattcacccg
gagagtcgcacttgtgacctcactcgtatcgatgttgcagcattgcatcagagcatcgca
taa

DBGET integrated database retrieval system