KEGG   Cyanidioschyzon merolae: CYME_CMS083CHelp
Entry
CYME_CMS083C      CDS       T00175                                 

Definition
similar to histone acetyltransferase; Hat1p
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
cme  Cyanidioschyzon merolae
Brite
Enzymes [BR:cme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CYME_CMS083C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19:214081..215532
Genome map
AA seq 483 aa AA seqDB search
MTSPARGAVRKRLRRATAPDEALIAPNDSDPREAGTEAVANACSDPEVHANQVWKLKFVL
NEEDNAVNGAFYQPSFTHQIFPNERIRGYLEPNLYQVYDAVTLHCYLNFKYTAVVNPSKE
VTPVMSTLQSLLDECGGYTTDYEAFRQCSRNANEPLETALKTISTYDLHNETFIISEGVL
CSENKSPAQAALRALHRRLQFLTLLYIEAASFIDDEDPRWMIYLCRSRRDQRLVGFATVY
RFPAIEKLQEFDPHREKWRLAQLLILPPYQRAGHGTRFLHALYERARCVSEQTGRCVLEI
SIEDPAPALCCVRDLVDLEKLLTSDDASRQWAQSINASSPVPSRSELKTLAQRLRITAAQ
VRRLYEILRLHAMVSASAASGDVDPELEREYRLVVKRRLFRENEECFGLKNDDERKQMLA
EMYTSLMQESYHPVIAAAMRRGLIAPTRLERRTGSESELHVLVSGSKELLLRNSAQVSES
GST
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcccagcgcggggagcagttaggaagcgacttcgacgtgccacagcaccagat
gaagcactgatcgctccaaacgacagtgatccccgcgaagctggtaccgaagcagtggca
aacgcctgcagcgatccggaggttcacgcaaaccaagtttggaaacttaagtttgtccta
aacgaagaggacaacgctgtgaacggcgctttctatcagccttcgttcactcatcaaatc
tttccgaacgagcgcatcaggggctacctcgagcccaacctgtaccaggtctatgacgcg
gtcacgttgcactgttatctgaatttcaagtacacagcagttgtgaaccctagcaaagag
gtcacacccgttatgtccacgcttcaatcgctgctcgatgagtgcggtggctacacaacg
gactacgaggcgtttcgacaatgcagtcgcaatgcgaatgaaccgctcgaaacagctctg
aaaaccattagcacgtacgaccttcacaacgaaacgtttatcatctccgagggcgttcta
tgttcagaaaacaagtctcccgcacaggcggctcttcgtgcgctgcatcgccgtctgcag
ttcctaacactactctacatcgaagctgcctcgttcattgacgatgaggatccgcggtgg
atgatttacctttgtcgctccagacgcgatcagcggcttgtagggtttgcgacagtctac
cgcttccccgcaatcgagaagctacaagaatttgatccccaccgcgagaaatggagactc
gctcaactgctgattctgccgccctatcagagagcggggcacggtacgcgtttcttgcat
gcgctttacgaacgagctcgttgcgtctctgaacagaccggtcgctgcgttctcgaaatc
agcatcgaagatccagcgccagccctttgttgtgtaagagatctggtggacttggaaaag
ctgcttacaagcgatgatgcttctcgacagtgggcgcagtcgattaacgcatctagccca
gtcccgagtcgctccgagctgaagacgctagcccagcgtctgcgtattactgcggcgcag
gtgcggcgactctatgaaatccttcgtttgcatgcaatggtgagtgccagtgccgcatct
ggagacgtcgaccccgaattggagcgggaataccgtctagttgtcaaacggcgtctattt
cgcgaaaatgaggaatgttttggcttgaaaaacgatgatgaacgaaagcaaatgctcgca
gagatgtatacttcgctgatgcaggaaagctaccacccagtcattgctgctgcgatgcgc
agagggctaattgcaccaacaaggcttgaaaggcgcacgggttccgaatccgaactgcat
gtactggtttcaggctccaaggaactactactgcgcaattctgcacaagtatcagagagc
ggctctacctga

DBGET integrated database retrieval system