KEGG   Cyanidioschyzon merolae: CYME_CMS286CHelp
Entry
CYME_CMS286C      CDS       T00175                                 

Definition
cytochrome-b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cme  Cyanidioschyzon merolae
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cme00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CYME_CMS286C
Enzymes [BR:cme01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CYME_CMS286C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19:724593..725465
Genome map
AA seq 290 aa AA seqDB search
MFTFLASSTIETNTSFASLVLVSVVVLASAWLWHRYSNRAGERAPALKPDTFTRFRLVAK
TVVSHNTRLFRFALPFPDQLLGLPPGQHVVLRARVPDAEEPILRPYTPVSKPETRGYFEL
LVKVYPAPSGKMGRYLDALEPGRDFVEARGPSGTFSYQRNMVAELGMIAGGTGITPMWQL
IQVILSDPSDKTRIKLIFANVKEEDILLRSAIDAAAAQYAERFTRFYVLNEPPAEWSMGI
GFVTQEHIRSFIGLPDASKMVLICGPPPMNKAMREHLEALGYDKAAVFRF
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgttcacgtttttggcctcatcgacgatcgaaacgaatacgtcgtttgcatctttggta
ctggtgagcgttgtcgtgctggcaagcgcttggctatggcaccggtatagcaaccgcgct
ggcgagagagcacctgcccttaagcctgatacgttcacccggttccgtctggtagccaaa
accgtcgtgtcccataacacgcgtctgtttcggttcgcgcttccgttccctgatcaacta
cttggtctgccgccagggcagcacgttgtgctacgtgcgcgcgttcctgacgccgaggag
ccaattctccgaccgtacacaccggtgtcgaaaccggaaacacgcggttacttcgagttg
ctcgtgaaggtctatcctgcgcctagcggaaaaatgggtcgctatctagacgctctggaa
ccgggaagagactttgtggaagcacgaggcccaagcggaaccttcagttaccaacggaac
atggttgcagaacttggtatgatcgcaggcggcacggggatcacgcccatgtggcaattg
attcaagtaatcctgagtgacccttctgataagactcgaatcaaactgatctttgcaaat
gtgaaagaagaagatattttattgcgttctgcgatcgatgctgcagcagcgcaatacgcg
gagcgattcactcgtttttacgtcctaaacgagccgcctgctgaatggagcatgggcata
ggtttcgttacgcaagagcacatccgaagttttataggtctcccggatgcgagcaagatg
gtgctcatctgcggcccgccgccgatgaacaaggcaatgcgcgagcatctcgaggccctt
ggctacgacaaagccgctgtgtttcggttctaa

DBGET integrated database retrieval system