KEGG   Cyanidioschyzon merolae: CymeCp013Help
Entry
CymeCp013         CDS       T00175                                 

Gene name
rbcL
Definition
ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
Orthology
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
cme  Cyanidioschyzon merolae
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Class
Metabolism; Overview; Carbon metabolism [PATH:cme01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:cme00630]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:cme00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
CP:7504..8970
Genome map
AA seq 488 aa AA seqDB search
MAQSVQERTRLKNKRYESGVIPYAKMGYWNPNYVVKDSDMLALFRVTPQPGVDPIEAAAA
VAGESSTATWTVVWTDLLTACDVYRAKAYRVDPVPTAPDQYFVYIAYDIDLFEEGSIANL
TASIIGNVFGFKAVKALRLEDMRIPFSYLKTFQGPATGVIVERERLNKFGRPLLGCTVKP
KLGLSGKNYGRVVYEGLKGGLDFLKDDENINSQPFMRWRDRYLYVMEGVNRAAAASGEVK
GSYLNVTAATMEECYKRAEFAKEVGSVIIMIDLVIGYTAIQTMAIWARENNMILHLHRAG
NSTYSRQKNHGINFRVISKWMRMAGVDHIHAGTVVGKLEGDPIIIKGFYNTLLLPKLEVN
LPQGLFFEMDWASLRKTLPVASGGIHAGQMHQLLHYLGEDVVLQFGGGTIGHPDGIQAGA
TANRVALEAMVLARNEGRDYFNEGPQILRDAAKNCGPLQTALDLWKDIAFNYTSTDTSDF
VETPTANV
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggctcaatccgtacaagaacgtacaaggttaaaaaacaaacgttacgaatctggtgtg
attccgtatgccaaaatgggttattggaatccaaactatgtagtaaaagatagtgatatg
ttagcgttgttccgcgtaactccacaaccaggggtagatccaattgaagcggcagcagca
gtagcaggtgaatcttcaacagctacatggactgtagtatggactgatttattaacagct
tgtgatgtatatcgtgcaaaagcttatagagtagatccagtacctacagctccagatcaa
tactttgtttatattgcttacgacattgacctatttgaagaaggttctattgccaacttg
acagcatccatcattggaaatgtgtttggtttcaaagcagtaaaagcactgcgtttggaa
gatatgcgcattcctttctcttatttaaaaactttccaagggccagcaacaggtgtgatt
gtagaacgtgaacgtcttaacaaatttggacgtccattattaggttgtacagtgaaacca
aaactaggtttgtctggtaaaaactacggacgtgtagtttatgaaggtttgaaaggtgga
ttggacttcctgaaagatgatgaaaacattaattcacaacctttcatgcgttggagagat
cgttacttatatgtaatggaaggtgtgaatagagcagccgcagcatctggcgaagtcaaa
ggttcatatttgaacgtcactgccgctactatggaagaatgttataagagagcagaattt
gcgaaagaagtaggttctgtgattattatgatagacctagtgatcggttacacagctatt
caaacaatggccatttgggcacgtgaaaataacatgattttacacttacatagagcaggt
aactccacttactctcgtcagaaaaatcatggtatcaacttccgtgtcatttcgaaatgg
atgcgtatggcaggtgtagaccatattcatgcaggaacagtagtaggtaaactagaaggg
gatccaattatcattaaaggtttctataacacattattgttacctaaattagaagttaat
ttaccacaaggtttattcttcgagatggactgggcatctttacgcaaaacgcttcctgta
gcttcaggtggtattcatgcaggtcagatgcaccaattacttcattatttaggtgaagat
gtggtcttacaatttggtggaggaacaatcggtcacccagatggtattcaagcaggtgcc
acagctaaccgtgtagcattggaagctatggtcttagctcgtaatgaaggtcgtgactat
ttcaatgaaggtcctcaaattttacgagatgcagcgaaaaattgtggtcctcttcaaacc
gctttagatttatggaaagatattgctttcaactacacttctacagatacatctgatttc
gtagaaacaccaacagctaacgtataa

DBGET integrated database retrieval system