KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_0049Help
Entry
CMM_0049          CDS       T00529                                 

Gene name
nagA
Definition
putative beta-N-acetylglucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CMM_0049 (nagA)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    CMM_0049 (nagA)
Enzymes [BR:cmi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CMM_0049 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
65645..67468
Genome map
AA seq 607 aa AA seqDB search
MAHELEPDNGSSFSRRGFLTAAASIGAAVAVQATEEGGDAARASTANIDVVRLVQGMSLE
DKVAQLFVLAVSGRTADTADPAAVTANRAAYGVATPAEVVARHRPGGIIYFAGEKDNLVD
PRQIARLSGDLQRASQGAGRIPLLVSTDQEQGGYVVRAPCTLLPGQMGLASSPSSSADVR
AVATITRDELLAMGINQAFAPVVDVASNPANPIIHVRSFGDDPDRVALLAQSQIGTFQKR
QGIVAAAKHFPGHGATDTDSHTGLPVNNRSRSELEDNDLPPFAAAIKSGVGVIMSAHIVV
PALDSSGDPATLSYPILTGVLRQKLGYDGVVITDALDMAGVRQRYSDARVPVLAIKAGVD
QLLTPPDFFAARDGVLAAIRAGELTEARIDESVTRILRLKQRFGLLTTAKVHGDPSIVRS
VTHLATAAEVTDRTITVLKDDDGLLPLPARPRKVLVTGWGAVTTASLADVLTAHGDTTTL
STTGISPDAATVTSAATLAKQVDLVVVCTRNLGADTSSGQLSLVSALIASGTPVISVAVL
EPYDIAHTPQVRTHLLTYSYAKNALEALGRVLHGEVAGTSVLAVDIPFSDGTDVLFPRGS
HVRRTRS
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggctcacgaattagaacctgacaacggtagctccttcagccgaaggggttttcttacc
gccgcggcctccatcggcgctgcggtcgccgtgcaggcgacggaggaagggggcgacgca
gctcgtgcatcgacagcgaacattgatgtcgtccgcctggtccagggcatgtcgctcgag
gataaggtcgcacagttgttcgtcctcgcggtctccggccgtacggccgacaccgcagac
cccgcggctgtgacggccaatcgcgcggcttacggcgtcgctactccggcggaagtcgtc
gcccggcaccggcctggcggcatcatctacttcgccggagagaaggacaacctcgtcgac
ccgcggcagatcgcgcggctgtccggcgacttgcagcgtgcgtcacagggagcgggccga
atccctctcctcgtctccacggatcaagagcagggaggctatgtcgtgcgcgctccgtgc
acgttgcttcccggacagatgggattggcctcgagcccgagttcctctgccgacgttcgc
gcggtggcgaccatcacgcgggacgagctcctcgcgatgggcatcaaccaggccttcgcg
ccggtggtggatgtggcctccaaccccgcaaacccaatcatccacgtgcgctccttcggg
gacgatccggaccgggttgctttgctcgcgcagtcccagatcggcacgttccagaagcgg
caggggatcgtggctgcggcaaagcacttccccggtcacggcgccaccgacactgatagc
cacaccggccttcccgtaaacaaccgaagccgctcggaactggaggacaacgacctcccg
cccttcgccgcggcaatcaagtccggcgtaggcgtcatcatgtccgcccacattgtcgtg
ccggccctcgactccagcggcgacccggctaccctgtcctaccccatcctcaccggagtg
ctccgccaaaagctcgggtacgacggtgtcgtcatcacggatgcacttgacatggcgggt
gtacgacagcgctacagcgatgcgcgcgttcccgtgctggcgatcaaggccggagtcgac
cagctgctcacgcctccagactttttcgccgcacgcgacggggtcctcgcggccatccgt
gccggcgagctcacggaggcgcgaatcgatgagtccgtgacccgcatcctgcgtctcaag
cagcgctttggactcctcaccacagcgaaggtccatggcgacccctctatcgtccggagc
gtgacgcacctcgcgaccgctgcggaggtcaccgatcgcaccatcacggtcctgaaggac
gacgacggcctcctccctctgccagctcgaccccggaaggtgctggtgaccggttggggc
gccgtcaccaccgcaagcctcgccgacgtactcaccgctcatggagacaccaccacgctc
tccaccaccggcatctcaccagatgcggcgaccgtcacgagtgcagcgacactcgcaaag
caggtcgacctcgtcgtagtgtgtacgcgcaatctgggcgctgacacgagctccggacag
ttgagcctcgtatccgcgcttatcgcgtccggtaccccggtcatctccgtcgcggtgctg
gagccgtatgacatcgctcacactccccaggtacgcacgcacctccttacatactcgtac
gcgaagaacgccctcgaagcgttgggtcgtgtcctccacggagaagttgcggggaccagc
gtgctggccgtggacatcccattcagcgacggcacagacgtgctctttccgcggggttcg
cacgtcaggcgcacccgctcctga

DBGET integrated database retrieval system