KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_0355Help
Entry
CMM_0355          CDS       T00529                                 

Gene name
bgaA
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CMM_0355 (bgaA)
  Lipid metabolism
   00600 Sphingolipid metabolism
    CMM_0355 (bgaA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CMM_0355 (bgaA)
Enzymes [BR:cmi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CMM_0355 (bgaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
431769..434759
Genome map
AA seq 996 aa AA seqDB search
MSHLDDVAPGSASRLEPRARFATDAPVHSLDGDWRFRLLPEAPVDAAGRAPAVADPALDD
AALDAAGWTTLPVPSHWVLHGHGSPAYTNLQYPFPIDPPHVPDANPTGEHRRTFELPASF
ADAERVLLRTDGIEGLATFWVNGVEAGWTTGSRLTTELDVTELLVPGENVLGIRVHQWSA
ASYLEDQDQWWLPGIFRPVELLARPAGALDDVRVRADRDPADGSGRLDVQVDGAFPVVVR
VPELGIHATWETAADVAPVAIPAVDAWSAERPRLYDATVSSPGETASLRIGFRTVRIDGD
ALLVDGRRLTFRGVNRHESHPERGRVFDEAEARADLELMKRSGVNAIRTSHYPPHPRLID
IADELGLWVVLECDLETHGFWDVEWRDNPSDDPRWRDAYLDRIARTVGRDRNHPSIVMWS
LGNESGTGRNIAAMSAWVRRADPTRPVHYEGDLTGEHTDVYSRMYPTLEEIDSVCGTPVA
SIHETTGATGAKQRAKPFILCEYGHAMGNGPGSLADYEDAIDRWPRLHGGFVWEWRDHGL
LARTADGRHFHAYGGDFDEPVHDGPFVMDGLLLSDGTPTPGLEELAAVIAPVRVRVAADG
SGVRVENRRHSASTDDVDLVWILAHDGRPVARGILEHTPLAAGDAATIPLPVEARAAGHA
EEAHVTVQVVTRHDAPWAEAGHVVSSHQALVRDRPAPRPRPAGRWRGDSLGAGTFDAHGD
LVAWAGVPVRGPRLELWRAPTENDRGAGQGSYELAEPEPTRGRGAEETPPSADRWRERGL
HRLTHRLLGTSRTDSGLETRMRVQAAHSGAGVDVAFRWTATDRGLLLATEVVPFGAWDCT
WPRVGVRIDLPGALAEHPVAWHGTGPGESYADSRTAARVGRFASSVDGLAVAYARPQETG
HRPELRSLVVGDGCTTPLTLTTVPDGSGHRPGFQLSRWTPQQMTDVGHPHELPAPDGLHL
FIDDAQHGLGSRACGPDVLPRHALWPSLRTCEVLLG
NT seq 2991 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacctcgacgacgtcgcccccggatccgcctcgaggctcgagccgcgcgcccgg
ttcgcgaccgacgcgcccgtccactccctcgacggcgactggcggttccgcctgctgcct
gaggcgccggtcgacgccgccggccgcgcacccgcggtcgcggatccggcgctcgacgac
gccgcgctcgacgcggccggctggaccacgctgcccgtcccgtcgcactgggtgctgcac
ggccacgggtcgcccgcgtacacgaacctgcagtacccgttccccatcgacccgccgcac
gtgcccgacgcgaacccgaccggcgagcaccggcgcacgttcgagctgccggcgtcgttc
gcggacgccgagcgcgtgctgctgcgcaccgacgggatcgaggggctcgcgacgttctgg
gtcaacggcgtcgaggcgggctggacgaccggcagccgcctcacgaccgagctcgacgtg
acggagctgctcgtccccggcgagaacgtgctcgggatccgcgtgcaccagtggtccgcc
gcctcctacctcgaggaccaggaccagtggtggctgcccggcatcttccgcccggtcgag
ctgctcgcgcggcccgccggcgcgctcgacgatgtgcgggtgcgtgccgaccgcgatccg
gccgacggatccggccgcctggacgtgcaggtggacggcgcgttccccgtggtggtgcgc
gtgccggagctggggatccacgcgacctgggagaccgcggccgacgtcgcgcccgtcgcg
atccccgcggtcgacgcctggagcgccgagcggccgcgcctctacgacgcgaccgtgtcg
tcgcccggggagaccgcgagcctgcggataggtttccgcacggtgcgcatcgacggcgac
gcgctgctcgtcgacggccgccgcctcaccttccgcggcgtgaaccggcacgagtcgcac
cccgagcgcggccgcgtgttcgacgaggccgaggcgcgcgccgacctggagctgatgaag
cggagcggagtgaacgcgatccgcacctcgcactacccgccgcatccgcgcctgatcgac
atcgccgacgagctcggcttgtgggtcgtgctcgagtgcgacctcgagacgcacggcttc
tgggacgtcgagtggcgggacaacccgtccgacgacccgcgctggcgcgacgcctacctc
gaccgcatcgcgcgcaccgtcggccgcgaccgcaaccacccgtcgatcgtgatgtggtcg
ctcggcaacgagtccggcaccgggcgcaacatcgcggccatgtcggcgtgggtgcggcgc
gcggatccgacccgtcccgtgcactacgagggcgacctcacgggcgagcacaccgacgtc
tactcgcgcatgtacccgacgctcgaggagatcgactccgtgtgcggcacgcccgtcgcg
agcatccacgagaccacgggcgcgaccggcgcgaagcagcgcgcgaagccgttcatcctg
tgcgagtacgggcacgcgatgggcaacggccccggatccctcgccgactacgaggacgcg
atcgaccgctggccgcgcctgcacggcggcttcgtgtgggagtggcgcgaccacgggctg
ctcgcgcgcaccgccgacggccggcacttccacgcctacggcggcgacttcgacgagccc
gtgcacgacggccccttcgtgatggacggcctgctgctctccgacggcacgcccacgccc
ggcctcgaggagctcgccgcggtcatcgcgccggtgcgcgtgcgggtcgcggccgacgga
tccggcgtgcgggtcgagaaccggcggcacagcgcatccaccgacgacgtcgacctggtg
tggatcctcgcccacgacggcaggcccgtcgcccgcgggatcctcgagcacacgccgctg
gccgccggcgatgcggcgacgatcccgctgcccgtcgaggcgcgcgccgccggccacgcc
gaggaggcgcacgtgaccgtgcaggtcgtcacgcgccacgacgcgccctgggccgaggcg
gggcacgtcgtgtcgtcgcaccaggcgctcgtgcgcgaccggcccgcgccccgaccgcgg
cctgccgggcgctggcgcggcgactccctcggcgccgggaccttcgacgcccacggcgac
ctcgtcgcgtgggccggcgtgcccgtgcgcggcccgcggctggagctgtggcgcgcgccc
accgagaacgaccgcggggcaggccagggatcctacgagctggccgagcccgagcccacc
cgcggccgcggcgccgaggagacgccgccgtcggcggaccggtggagggagcgcgggctg
caccggctcacccaccggctcctcggcacgagccgcaccgacagcggcctcgagacgcgg
atgcgggtgcaggccgcgcactcgggcgcgggcgtcgacgtcgccttccgctggaccgcg
accgatcgcggcctcctgctcgccaccgaggtcgtgccgttcggcgcgtgggactgcacg
tggccgcgcgtcggcgtgcgcatcgacctgccgggcgcgctcgccgagcatccggtcgcc
tggcacggcacggggccgggggagtcctacgcggacagccgcacggccgcgcgcgtcggc
cgcttcgcgtcgagcgtcgacggcctcgcggtcgcctacgcccgcccgcaggagacgggc
caccggccggagctgcgctcgctcgtggtcggcgacggatgcacgaccccgctcaccctg
acgaccgtgcccgacggatccggccaccgccccggcttccagctctcccgctggaccccg
cagcagatgaccgacgtcggccacccgcacgagctgcccgcccccgacggcctgcacctc
ttcatcgacgacgcccagcacggcctggggtcgcgcgcgtgcggccccgacgtgctcccg
cgccacgcgctctggccgtcgctgcgcacgtgtgaggtgctgctggggtag

DBGET integrated database retrieval system