KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_0588Help
Entry
CMM_0588          CDS       T00529                                 

Gene name
hemY
Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CMM_0588 (hemY)
Enzymes [BR:cmi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CMM_0588 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
667869..669308
Genome map
AA seq 479 aa AA seqDB search
MSSDPRQAAGEVDPTDVVVIGGGVGGLIAARACALAGKRVILVEASPSLGGTVGSHVVDG
LRLDSGAESFATRRGTVATFLGELGLADLIVQPNPDGAWVQLAERAIQLPRTGLLGIPAH
PFDATIATAIGRAGVARAKADLLLPAAVGAKERTLGGLVRARMGDRVVDRLVAPIVSGVH
SAHPDEVDADAVAPGLRAGLAEQGSLGRAVASMRAASPAGSAVSGIVGGVHLLVDALVAD
LARLGVDVRTSLAVESVHRHRSHEGAAAYDDWHVELADGRGVDAAGVILAIPAAGLIHLF
QGLAPRAVTEGWPAPSSVELVTLVVRAPELDAAPRGTGVLVAADAPGIRAKALTHATAKW
PWLKEQAGDRHVLRLSYGRAGGDDDTAGVPDDELTAIAVHDASALLGVDLAGRVTGSARV
RWTNALPFAASGHRERVQAVRDEAAEHPGLEITGSTVAGTGLASVVADAQAAAARLLAR
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
gtgagtagcgacccgcggcaggcagccggcgaggtcgacccgaccgacgtcgtcgtgatc
ggcggcggcgtgggcggcctcatcgccgcgcgcgcctgcgccctcgccgggaagcgcgtg
atcctcgtggaggcgtcgccctcgctcggcggcaccgtcggatcccacgtggtggacggc
ctccgcctcgacagcggcgccgagagcttcgccacccgccgcggcaccgtcgccacgttc
ctgggggagctgggcctcgcggacctgatcgtgcagccgaacccggacggggcgtgggtg
cagctcgccgaacgcgccatccagctgccgcgcacgggcctgctcgggatccccgcgcac
ccgttcgacgccaccatcgcgaccgcgatcggccgggccggcgtcgcccgcgccaaggcc
gacctcctcctccccgccgccgtcggcgcgaaggagcgcacgctcggcggcctcgtccgc
gcccgcatgggcgaccgcgtggtcgaccggctggtcgcccccatcgtctccggcgtgcac
agcgcccaccccgacgaggtcgacgccgacgcggtcgcgcccggcctccgcgccgggctc
gccgagcaggggtcgctggggcgcgcggtcgcgtcgatgcgcgccgcctctcccgcggga
tccgccgtcagcggcatcgtcggcggcgtgcacctgctggtggacgcgctggtcgccgac
ctcgcgcgcctcggcgtggacgtccgcacgtcgctcgcggtcgagtccgtgcaccggcac
cgctcccacgagggcgccgccgcgtacgacgactggcacgtcgagctcgccgacggccgg
ggcgtcgacgcggcgggcgtcatcctcgccatccccgcggcgggcctcatccacctcttc
cagggactcgcgccgcgcgcggtcacggagggctggcccgcgccgtcctccgtcgagctg
gtcacgctcgtcgtgcgcgcgcccgagctcgacgccgctccgcgcggcaccggcgtgctg
gtcgcggccgacgccccggggatccgcgccaaggccctcacgcacgccaccgccaagtgg
ccgtggctgaaggagcaggcgggcgaccgccatgtgctccgcctctcctacgggcgcgcg
ggcggcgacgacgacaccgcgggcgtccctgacgacgagctcaccgcgatcgccgtccac
gacgcgtcggcgctgctcggcgtcgacctcgccggccgcgtcaccggatccgcccgcgtg
cgctggaccaacgccctcccgttcgccgcgtccggccaccgcgagcgcgtgcaggccgtg
cgcgacgaggcggccgagcatccggggctcgagatcaccgggtccaccgtcgcgggcacc
gggctcgcctccgtggtggccgacgcgcaggccgccgcggcgcgcctcctggcccgctga

DBGET integrated database retrieval system