KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_0588Help
Entry
CMM_0588          CDS       T00529                                 

Gene name
hemY
Definition
(GenBank) protoporphyrinogen oxidase (YP_055020.1| putative protoporphyrinogen oxidase, HemY [Propionibacterium acnes KPA171202]; ZP_00294157.1| COG1232: Protoporphyrinogen oxidase [Thermobifida fusca]). InterPro: Protoporphyrinogen oxidase proto_IX_ox: protoporphyrinogen oxidase domain; High confidence in function and specificity
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
cmi00860  Porphyrin and chlorophyll metabolism
cmi01100  Metabolic pathways
cmi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CMM_0588 (hemY)
Enzymes [BR:cmi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CMM_0588 (hemY)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     CMM_0588 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase FAD_oxidored NAD_binding_8 FAD_binding_2 Pyr_redox_2 HI0933_like DAO AlaDh_PNT_C FAD_binding_3 Thi4 Pyr_redox GIDA Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: CAN00613
UniProt: A5CNH6
Position
667869..669308
Genome map
AA seq 479 aa AA seqDB search
MSSDPRQAAGEVDPTDVVVIGGGVGGLIAARACALAGKRVILVEASPSLGGTVGSHVVDG
LRLDSGAESFATRRGTVATFLGELGLADLIVQPNPDGAWVQLAERAIQLPRTGLLGIPAH
PFDATIATAIGRAGVARAKADLLLPAAVGAKERTLGGLVRARMGDRVVDRLVAPIVSGVH
SAHPDEVDADAVAPGLRAGLAEQGSLGRAVASMRAASPAGSAVSGIVGGVHLLVDALVAD
LARLGVDVRTSLAVESVHRHRSHEGAAAYDDWHVELADGRGVDAAGVILAIPAAGLIHLF
QGLAPRAVTEGWPAPSSVELVTLVVRAPELDAAPRGTGVLVAADAPGIRAKALTHATAKW
PWLKEQAGDRHVLRLSYGRAGGDDDTAGVPDDELTAIAVHDASALLGVDLAGRVTGSARV
RWTNALPFAASGHRERVQAVRDEAAEHPGLEITGSTVAGTGLASVVADAQAAAARLLAR
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
gtgagtagcgacccgcggcaggcagccggcgaggtcgacccgaccgacgtcgtcgtgatc
ggcggcggcgtgggcggcctcatcgccgcgcgcgcctgcgccctcgccgggaagcgcgtg
atcctcgtggaggcgtcgccctcgctcggcggcaccgtcggatcccacgtggtggacggc
ctccgcctcgacagcggcgccgagagcttcgccacccgccgcggcaccgtcgccacgttc
ctgggggagctgggcctcgcggacctgatcgtgcagccgaacccggacggggcgtgggtg
cagctcgccgaacgcgccatccagctgccgcgcacgggcctgctcgggatccccgcgcac
ccgttcgacgccaccatcgcgaccgcgatcggccgggccggcgtcgcccgcgccaaggcc
gacctcctcctccccgccgccgtcggcgcgaaggagcgcacgctcggcggcctcgtccgc
gcccgcatgggcgaccgcgtggtcgaccggctggtcgcccccatcgtctccggcgtgcac
agcgcccaccccgacgaggtcgacgccgacgcggtcgcgcccggcctccgcgccgggctc
gccgagcaggggtcgctggggcgcgcggtcgcgtcgatgcgcgccgcctctcccgcggga
tccgccgtcagcggcatcgtcggcggcgtgcacctgctggtggacgcgctggtcgccgac
ctcgcgcgcctcggcgtggacgtccgcacgtcgctcgcggtcgagtccgtgcaccggcac
cgctcccacgagggcgccgccgcgtacgacgactggcacgtcgagctcgccgacggccgg
ggcgtcgacgcggcgggcgtcatcctcgccatccccgcggcgggcctcatccacctcttc
cagggactcgcgccgcgcgcggtcacggagggctggcccgcgccgtcctccgtcgagctg
gtcacgctcgtcgtgcgcgcgcccgagctcgacgccgctccgcgcggcaccggcgtgctg
gtcgcggccgacgccccggggatccgcgccaaggccctcacgcacgccaccgccaagtgg
ccgtggctgaaggagcaggcgggcgaccgccatgtgctccgcctctcctacgggcgcgcg
ggcggcgacgacgacaccgcgggcgtccctgacgacgagctcaccgcgatcgccgtccac
gacgcgtcggcgctgctcggcgtcgacctcgccggccgcgtcaccggatccgcccgcgtg
cgctggaccaacgccctcccgttcgccgcgtccggccaccgcgagcgcgtgcaggccgtg
cgcgacgaggcggccgagcatccggggctcgagatcaccgggtccaccgtcgcgggcacc
gggctcgcctccgtggtggccgacgcgcaggccgccgcggcgcgcctcctggcccgctga

DBGET integrated database retrieval system