KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_0597Help
Entry
CMM_0597          CDS       T00529                                 

Gene name
hemD
Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CMM_0597 (hemD)
Enzymes [BR:cmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CMM_0597 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
675872..676711
Genome map
AA seq 279 aa AA seqDB search
MTSTDQKPLKGWRVLVPRGGPWGDGVAYDLRAQGATPVVAPMINFAATQDAQALESALAD
LAAGSFDWLTVTSATTVDVLASHRAVVPEGTRIAAVGETTAAALVAAGYTVDFVPSIDSS
ATALLEEWTEMAAGSPRRRVLTLRSEIAKPTLTDGLIARGHDVRSVVAYRTVGVLVSDRI
REDVSSGRVRAILVTSGSVAEQVHEQLGDVPDGVLIACIGPRTAKDARRSGVRVDVVASE
RSAASLIQALVEIARHEEPRPDTAGLTGLADLLDRSATE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgacagaccagaagcccctgaagggctggcgcgtcctcgtgccccgcggcggg
ccgtggggtgacggcgtcgcgtacgacctccgcgcgcagggcgccacgcccgtcgtcgcg
cccatgatcaacttcgccgccacgcaggacgcgcaggcgctggagtcggccctcgccgac
ctggccgcgggatccttcgactggctcaccgtgacgagcgccaccacggtcgacgtgctc
gcatcgcaccgcgccgtcgtgcccgagggcacgcgcatcgcggccgtcggcgagaccacg
gccgccgcgctcgtcgccgcgggctacaccgtcgacttcgtgccctccatcgactcgtcg
gccaccgcgctcctggaggagtggaccgagatggccgccgggtccccgcgccgccgggtg
ctcacgctccggtccgagatcgcgaagccgacgctcaccgacggcctcatcgcgcgcggg
cacgacgtgcgctcggtcgtcgcgtaccgcacggtcggcgtgctcgtcagcgatcggatc
cgcgaggacgtctcctccggccgcgtccgcgccatcctcgtcacctcgggcagcgtcgcg
gagcaggtgcacgagcagctcggcgacgtgcccgacggcgtgctcatcgcctgcatcggc
ccgcgcaccgcgaaggacgcccgccgctccggcgtgcgcgtggacgtcgtcgcctccgag
cgctcggccgcgtcgctcatccaggccctggtcgagatcgcccgtcacgaggagccgcgt
cccgacacggcggggctgaccggcctcgctgacctcctcgatcggagcgccaccgaatga

DBGET integrated database retrieval system