KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_0604Help
Entry
CMM_0604          CDS       T00529                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase (fructose 6-phosphate 1-phosphotransferase) (ZP_00293787.1| COG0205: 6-phosphofructokinase [Thermobifida fusca]; PFP_AMYME Pyrophosphate--fructose 6-phosphate 1-phosphotransferase (6-phosphofructokinase, pyrophosphate dependent)(Pyrophosphate-dependent 6-phosphofructose-1-kinase)(PPi-dependent phosphofructokinase)). cd00763,Bacterial_PFK, Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate.; Specificity unclear
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CMM_0604 (pfkA)
   00030 Pentose phosphate pathway
    CMM_0604 (pfkA)
   00051 Fructose and mannose metabolism
    CMM_0604 (pfkA)
   00052 Galactose metabolism
    CMM_0604 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CMM_0604 (pfkA)
Enzymes [BR:cmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CMM_0604 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     CMM_0604 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(682375..683400)
Genome map
AA seq 341 aa AA seqDB search
MRIGILTSGGDCPGLNAVIRGAVLKGTTIHKQEFVGFRDGWRGVVDGDVMPLARRDIQGI
GKQGGTILGTSRTNPFEGDGGVERIQENLDRLGIDAILAIGGEGTLAAAKRLTDAGLKIV
GVPKTVDNDLDATDYTFGFDTAVQIATDAMDRLRTTGDSHSRCMVAEVMGRHVGWIALHS
GMAAGAHAILIPEQKTSMDEIIGWVRSAYDRGRAPLVVVAEGFIPEHASDAHGERGLDAF
GRPRLGGIGEQIAPIIEERTGIETRATTLGHIQRGGTPSSYDRVLATRLGLAAVDSVRDG
HWGRMVALRGTDIVHVGFEEALGRLKTVPQQRYDEAAILFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcatcggaatcctcacctcaggcggagactgccccggactcaacgcggtcatccgc
ggggcggtgctcaagggaacgaccatccacaagcaggagttcgtgggcttccgcgacggc
tggcggggcgtcgtcgacggcgacgtcatgccgctcgcgcgccgcgacatccagggcatc
ggcaagcagggcggcacgatcctcggcaccagccgcacgaacccgttcgagggcgacgga
ggcgtggagcggatccaggagaacctcgaccgcctcggcatcgacgcgatcctcgcaatc
ggcggcgagggcacgctcgcggcagccaagcgcctcaccgacgcgggcctcaagatcgtc
ggagtccccaagaccgtcgacaacgacctcgacgccaccgactacacgttcggcttcgac
accgcggtgcagatcgcgaccgacgccatggaccgcctccgcaccacgggcgactcgcac
agccgctgcatggtggccgaggtcatgggcaggcacgtcggctggatcgcgctgcactcc
ggcatggccgcgggcgcgcacgcgatcctcatccccgagcagaagacgagcatggacgag
atcatcggctgggtccgctcggcctacgaccgcgggcgcgcgccgctcgtcgtcgtcgcg
gagggcttcatccccgagcacgcgtccgacgcgcacggcgagcgcgggctcgacgccttc
ggccgcccgcggctcggcggcatcggcgagcagatcgcgcccatcatcgaggagcgcacg
ggcatcgagacccgcgcgacgaccctcggccacatccagcgcggcggcacaccgtcgtcc
tacgaccgcgtgctcgccacccgcctcggcctcgccgcggtcgacagcgtgcgcgacggc
cactggggccgcatggtcgcgctccgcgggaccgacatcgtgcacgtgggcttcgaggag
gcgctcggccgcctcaagaccgtgccgcagcagcgctacgacgaggccgcgatcctcttc
ggctag

DBGET integrated database retrieval system