KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_0817Help
Entry
CMM_0817          CDS       T00529                                 

Gene name
pipB
Definition
proline iminopeptidase (EC:3.4.11.5)
Orthology
K01259  
proline iminopeptidase [EC:3.4.11.5]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Arginine and proline metabolism
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cmi00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
921336..922304
Genome map
AA seq 322 aa AA seqDB search
MQSLFPEIDPHDTGMLDVGDGQLLHWEVSGNPDGIPVVFLHGGPGGGTSPTHRRLFDPAR
YRIVLVDQRGCGRSTPHVSTPEADLSVNTTWHLVADLERLREHLGVERWLVFGGSWGSTL
ALAYAETHPARVTGLILRGIFTLRATELDWFYEGPAGMVYPDGWEAFTAPVPGVERGGII
AAYARLLADPDPAVHGPAAVAWSTWEASGITLLPKPDVVARFAEPTYALAFARIENHYFM
HGGWMEDGQLIRDAHLLRGIPTEIVQGRYDMCTPAVTAWDLHRALPEARFTMVPDAGHAF
DEPGILDALIQATERAADRLAR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcctcttccccgagatcgacccgcacgacaccggcatgctcgacgtgggggac
gggcagctcctccactgggaggtctcggggaacccggacgggatccccgtcgtcttcctg
cacggcggtcccggcggcggcacgagcccgacccaccgccgcctcttcgacccggccagg
taccgcatcgtgctcgtcgaccagcggggctgcggccggagcacgccgcacgtctccacg
ccggaggcggacctctccgtcaacaccacgtggcacctcgtcgccgacctcgagcggctg
cgggagcacctgggcgtggagcgctggctggtgttcggcggatcctggggctcgaccctc
gcgctcgcctacgccgagacgcacccggcccgcgtgaccggcctcatcctccgcggcatc
ttcaccctccgcgcgaccgagctcgactggttctacgaggggccggccggcatggtctac
cccgacggctgggaggcgttcacggcgcccgtgcccggggtggagcgcggcgggatcatc
gcggcgtacgcgcggctcctcgcggatcccgaccctgcggttcacgggccggccgcggtc
gcgtggtccacctgggaggcgtcgggcatcacgctgctgccgaagcccgacgtggtcgcg
cggttcgccgagccgacgtacgcgctcgcgttcgcgcgcatcgagaaccactacttcatg
cacggcggctggatggaggacgggcagctgatccgcgacgcgcacctgctgcggggcatc
ccgaccgagatcgtgcagggccgctacgacatgtgcaccccggccgtcaccgcgtgggac
ctccaccgggcgctgcccgaggcgcgcttcacgatggtgccggacgccgggcacgcgttc
gacgagccggggatcctcgacgcgctgatccaggcgaccgagcgcgccgccgaccggctg
gcgcgctag

DBGET integrated database retrieval system