KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_0845Help
Entry
CMM_0845          CDS       T00529                                 

Gene name
folE
Definition
(GenBank) High confidence in function and specificity; GTP cyclohydrolase I (YP_062947.1| GTP cyclohydrolase I [Leifsonia xyli subsp. xyli str. CTCB07]; NP_870186.1| GTP cyclohydrolase I [Pirellula sp. 1]). catalytic activity: gtp + 2 h(2)o = formate + 2-amino-4-hydroxy-6-(erythro-1,2, 3-trihydroxypropyl)dihydropteridine triphosphate. pathway: tetrahydrofolate biosynthesis; first step. pfam01227,GTP_cyclohydroI, GTP cyclohydrolase I. folE: GTP cyclohydrolase I
  KO
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CMM_0845 (folE)
Enzymes [BR:cmi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CMM_0845 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
966463..967047
Genome map
AA seq 194 aa AA seqDB search
MGVDRARIEAAVAELILAIGEDPGREGLATTPARVAEAYAEFFSGVGADPLRHLRETFPL
PETDAAPQPVIVTGIAFRSICEHHLLPFTGVAHLAYVPGERIVGLGRLPRVVDDLASRPQ
MQERLGEQIAEALERGLGARGVAVILDATHGCVTARGTRQAGSTTITIAARGSLAEPAAR
AEVLALLPTAAGRA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgtcgaccgggcgcgcatcgaggcggccgtggccgagctgatcctggccatcggc
gaggacccgggccgggagggcctcgcgaccaccccggcgcgggtagccgaggcgtacgcg
gagttcttctccggggtcggcgcggatccgctccggcacctgcgcgagacgttcccgctc
cccgagacggacgcagcgccgcagcccgtgatcgtgacgggcatcgcgttccgctccatc
tgcgagcaccacctgctgccgttcacgggcgtcgcgcacctggcctacgtgccgggggag
cggatcgtgggcctcggccggctgccgcgcgtggtcgacgacctcgcgtcgcgtccgcag
atgcaggagcggctgggcgagcagatcgccgaggcgctcgaacgcggactcggcgcgcgc
ggtgtcgccgtgatcctcgacgcgacgcacggctgcgtcaccgcgcggggcacccggcag
gccggcagcacgaccatcacgatcgcggcgcgcggctccctcgccgagcccgcggcgcgc
gccgaggtgctcgcgctgctgcccaccgcggccggtcgggcgtga

DBGET integrated database retrieval system