KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_0848Help
Entry
CMM_0848          CDS       T00529                                 

Gene name
folBK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CMM_0848 (folBK)
Enzymes [BR:cmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CMM_0848 (folBK)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     CMM_0848 (folBK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
968625..969515
Genome map
AA seq 296 aa AA seqDB search
MVTPLPADRILLTGLRVHAHHGVFAEERRDGQPFVIDLEVALDLAPAGGTDELGRTLHYG
ELAEEVAAAVGRDPVDLIETLAERVAGVVLAHPVARSVRVTVHKPDAPISVPFDDVAVVI
ERASALPAPGATVRAVLAVGSNLGDRRATVERALALIDEVPGLRLVRSSDLVESVAVTPE
GEDPTKPGYLNGVALVDAELGPHALLDALAAIERDLGRVRAERWGDRTIDLDVVAYGDAR
IHDDRLTLPHPRAAERAFVLGPWLQADPDAELPGRGRVDALLAALGSTADPAEARA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggtgacgcccctccccgccgaccgcatcctcctcaccgggctgcgcgtgcacgcccac
cacggcgtcttcgcggaggagcgccgcgacggccagccgttcgtgatcgacctcgaggtc
gcgctcgacctcgcgcccgccgggggcaccgacgagctcggccgcacgctgcactacggg
gagctcgccgaggaggtcgccgcggcggtcgggcgggatcccgtcgacctcatcgagacg
ctggccgagcgcgtcgcgggcgtcgtgctcgcgcatcccgtggcccggtcggtgcgcgtc
accgtgcacaagccggacgcgcccatctccgtccccttcgacgacgtggccgtcgtgatc
gagcgcgcgtccgccctgccggcgccgggcgcgaccgtgcgcgcggtgctggccgtggga
tccaacctcggcgaccggcgtgcgaccgtcgagcgcgcgctggccctgatcgacgaggtg
cccggcctccgcctcgtgcgctcctcggatctcgtggagtccgtcgccgtgacgcccgag
ggggaggacccgacgaagcccggctacctcaacggcgtcgcgctggtggacgccgaactg
ggcccgcatgcgctgctggacgccctggccgcgatcgagcgcgacctcggccgcgtgcgc
gccgagcgctggggcgaccgcacgatcgacctcgacgtcgtcgcgtacggcgacgcgcgg
atccacgacgaccgcctcacgctgccccacccgcgcgccgccgagcgcgccttcgtgctc
gggccctggctgcaggcggatcccgacgccgagctgcccggccgcggccgcgtcgacgcg
ctgctcgccgcgctgggatccaccgccgaccccgcggaggcccgcgcatga

DBGET integrated database retrieval system