KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_0922Help
Entry
CMM_0922          CDS       T00529                                 

Gene name
acsA1
Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cmi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cmi00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cmi00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cmi00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:cmi00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1060150..1062189)
Genome map
AA seq 679 aa AA seqDB search
MTMSTNPRSTQPGASSPAAPDQDEEGTTIPSRPATTAEPGPVHPPSEAFRATRVADESLA
ASAAADRLGFWADRARELLTWETPFETVLDWSDAPVARWFPEGRLNVAYNCLDRHVLAGH
GDRVALHWEGEPGDTRDLTYAELTAEVKRAANALGDLGVVAGDRVAIYLPMIPEAVIAML
AVARIGAVHSVVFGGFSAESLRARIDDAAARVVITADGGWRKGKVFPLKPAVDAALVGSA
GSVEHVLVVRRGENQVDWDESRDLWWHERVAAADPEHEAEAFEAEHPLFILYTSGTTGKP
KGILHTSGGYLTQAAYTHRNVFDLHPETDVYWCTADVGWITGHSYVVYGPLANGATQVVY
EGTPDTPEPGRWWDIVEKHGVTILYAAPTAIRSFMKTGREIPDARDLSSIRLLGSVGEPI
NPEAWRWYRDVIGGGDVPVVDTWWQTETGGIMISALPGITATKPGSAQSPIPGIEVAVVD
DQGEPVSRGESGLLVVTEPWPGMLRGIWGDPERYRETYWDRFGDRYFAGDGARLDEDGDI
WLLGRVDDVMNVSGHRLSTAEIESSLVAHPYVAEAAVVGASDEATGQAVVAFVILRSAEA
IALGDEDPNEVLRKHVSDQIGAIAKPRRVFVVHELPKTRSGKIMRRLLRDVAEGRAIGDT
TTLADTQVMHVISDRMSAG
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgtccacgaacccccgatcgacccagcccggagcctcgagccccgccgcgccc
gaccaggacgaggaggggacgaccatcccctcgcgcccggcgacgacggcggagccgggg
cccgtccacccgccgtcggaggcgttccgcgccacccgcgtggccgacgagtccctcgcc
gcgtccgccgccgccgaccgtctcggcttctgggccgaccgggcccgcgagctcctgacc
tgggagacgccgttcgagacggtcctcgactggtcggacgcccccgtcgcccgctggttc
ccggagggccggctcaacgtggcctacaactgcctcgaccggcacgtgctcgccggtcac
ggagaccgcgtcgcgctgcactgggagggcgagccgggcgacacccgcgacctcacgtac
gccgagctcaccgcggaggtcaagcgcgccgcgaacgccctcggcgacctgggcgtcgtc
gcgggtgaccgcgtcgcgatctacctgccgatgatcccggaggcggtgatcgcgatgctg
gccgtcgcgcgcatcggcgccgtccactccgtcgtgttcggcggcttcagcgccgagagc
ctgcgcgcgcgcatcgacgacgcggcagcccgcgtcgtcatcaccgcggacggcggctgg
cgcaagggcaaggtcttcccgctcaagcccgccgtggatgccgcgctggtcggatcggcc
ggatccgtcgagcacgtcctcgtcgtcaggcgcggcgagaaccaggtcgactgggacgag
agccgcgacctctggtggcacgagcgcgtcgcggcggcggacccggagcacgaggcggag
gcgttcgaggccgagcaccccctcttcatcctctacacgagcggcacgaccgggaagccg
aagggcatcctgcacacctcgggcggctacctcacgcaagccgcgtacacgcaccgcaac
gtcttcgacctgcaccccgagaccgacgtctactggtgcacggcggacgtcggctggatc
accggccacagctacgtcgtctacggcccgctcgcgaacggcgccacgcaggtcgtctac
gagggcacgccggacaccccggagcccggccgctggtgggacatcgtcgagaagcacggc
gtcacgatcctgtacgcggcgcccaccgcgatccgctccttcatgaagaccggccgcgag
atcccggacgcgcgcgacctctcctccatccgtctgctcggctcggtcggcgagcccatc
aacccggaggcgtggcgctggtaccgcgacgtcatcggcggcggcgacgtccccgtggtc
gacacgtggtggcagacggagaccggcggcatcatgatctccgcgctccccggcatcacc
gcgacgaagccgggatccgcgcagtcgcccatccccggcatcgaggtcgccgtggtcgac
gaccagggcgagcccgtgtcccgcggcgagagcggcctcctggtcgtgaccgagccctgg
cccggcatgctccgcggcatctggggcgacccggagcgctaccgcgagacctactgggac
cgcttcggcgaccgctacttcgcgggcgacggcgccaggctcgacgaggacggcgacatc
tggctgctcggccgggtggacgacgtgatgaacgtctccggccaccgcctgtcgaccgcg
gagatcgagtcctccctcgtcgcgcacccgtacgtcgccgaggctgcggtcgtcggcgcg
tccgacgaggcgaccggccaggcggtcgtggccttcgtgatcctccgctcggccgaggcg
atcgcgctcggcgacgaggacccgaacgaggtcctccggaagcacgtctccgaccagatc
ggcgccatcgcgaagccgcgtcgcgtgttcgtggtgcatgagctgccgaagacgcgctcg
ggcaagatcatgcgccggctgctgcgcgacgtggcggagggccgggcgatcggcgacacc
accacgctggcggacacacaggtgatgcacgtcatctccgaccgcatgagcgcgggctga

DBGET integrated database retrieval system