KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_0922Help
Entry
CMM_0922          CDS       T00529                                 

Gene name
acsA1
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
cmi00010  Glycolysis / Gluconeogenesis
cmi00620  Pyruvate metabolism
cmi00640  Propanoate metabolism
cmi00680  Methane metabolism
cmi01100  Metabolic pathways
cmi01110  Biosynthesis of secondary metabolites
cmi01120  Microbial metabolism in diverse environments
cmi01130  Biosynthesis of antibiotics
cmi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CMM_0922 (acsA1)
   00620 Pyruvate metabolism
    CMM_0922 (acsA1)
   00640 Propanoate metabolism
    CMM_0922 (acsA1)
  Energy metabolism
   00680 Methane metabolism
    CMM_0922 (acsA1)
Enzymes [BR:cmi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CMM_0922 (acsA1)
Lipid biosynthesis proteins [BR:cmi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CMM_0922 (acsA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAN00959
UniProt: A5CPG1
Position
complement(1060150..1062189)
Genome map
AA seq 679 aa AA seqDB search
MTMSTNPRSTQPGASSPAAPDQDEEGTTIPSRPATTAEPGPVHPPSEAFRATRVADESLA
ASAAADRLGFWADRARELLTWETPFETVLDWSDAPVARWFPEGRLNVAYNCLDRHVLAGH
GDRVALHWEGEPGDTRDLTYAELTAEVKRAANALGDLGVVAGDRVAIYLPMIPEAVIAML
AVARIGAVHSVVFGGFSAESLRARIDDAAARVVITADGGWRKGKVFPLKPAVDAALVGSA
GSVEHVLVVRRGENQVDWDESRDLWWHERVAAADPEHEAEAFEAEHPLFILYTSGTTGKP
KGILHTSGGYLTQAAYTHRNVFDLHPETDVYWCTADVGWITGHSYVVYGPLANGATQVVY
EGTPDTPEPGRWWDIVEKHGVTILYAAPTAIRSFMKTGREIPDARDLSSIRLLGSVGEPI
NPEAWRWYRDVIGGGDVPVVDTWWQTETGGIMISALPGITATKPGSAQSPIPGIEVAVVD
DQGEPVSRGESGLLVVTEPWPGMLRGIWGDPERYRETYWDRFGDRYFAGDGARLDEDGDI
WLLGRVDDVMNVSGHRLSTAEIESSLVAHPYVAEAAVVGASDEATGQAVVAFVILRSAEA
IALGDEDPNEVLRKHVSDQIGAIAKPRRVFVVHELPKTRSGKIMRRLLRDVAEGRAIGDT
TTLADTQVMHVISDRMSAG
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgtccacgaacccccgatcgacccagcccggagcctcgagccccgccgcgccc
gaccaggacgaggaggggacgaccatcccctcgcgcccggcgacgacggcggagccgggg
cccgtccacccgccgtcggaggcgttccgcgccacccgcgtggccgacgagtccctcgcc
gcgtccgccgccgccgaccgtctcggcttctgggccgaccgggcccgcgagctcctgacc
tgggagacgccgttcgagacggtcctcgactggtcggacgcccccgtcgcccgctggttc
ccggagggccggctcaacgtggcctacaactgcctcgaccggcacgtgctcgccggtcac
ggagaccgcgtcgcgctgcactgggagggcgagccgggcgacacccgcgacctcacgtac
gccgagctcaccgcggaggtcaagcgcgccgcgaacgccctcggcgacctgggcgtcgtc
gcgggtgaccgcgtcgcgatctacctgccgatgatcccggaggcggtgatcgcgatgctg
gccgtcgcgcgcatcggcgccgtccactccgtcgtgttcggcggcttcagcgccgagagc
ctgcgcgcgcgcatcgacgacgcggcagcccgcgtcgtcatcaccgcggacggcggctgg
cgcaagggcaaggtcttcccgctcaagcccgccgtggatgccgcgctggtcggatcggcc
ggatccgtcgagcacgtcctcgtcgtcaggcgcggcgagaaccaggtcgactgggacgag
agccgcgacctctggtggcacgagcgcgtcgcggcggcggacccggagcacgaggcggag
gcgttcgaggccgagcaccccctcttcatcctctacacgagcggcacgaccgggaagccg
aagggcatcctgcacacctcgggcggctacctcacgcaagccgcgtacacgcaccgcaac
gtcttcgacctgcaccccgagaccgacgtctactggtgcacggcggacgtcggctggatc
accggccacagctacgtcgtctacggcccgctcgcgaacggcgccacgcaggtcgtctac
gagggcacgccggacaccccggagcccggccgctggtgggacatcgtcgagaagcacggc
gtcacgatcctgtacgcggcgcccaccgcgatccgctccttcatgaagaccggccgcgag
atcccggacgcgcgcgacctctcctccatccgtctgctcggctcggtcggcgagcccatc
aacccggaggcgtggcgctggtaccgcgacgtcatcggcggcggcgacgtccccgtggtc
gacacgtggtggcagacggagaccggcggcatcatgatctccgcgctccccggcatcacc
gcgacgaagccgggatccgcgcagtcgcccatccccggcatcgaggtcgccgtggtcgac
gaccagggcgagcccgtgtcccgcggcgagagcggcctcctggtcgtgaccgagccctgg
cccggcatgctccgcggcatctggggcgacccggagcgctaccgcgagacctactgggac
cgcttcggcgaccgctacttcgcgggcgacggcgccaggctcgacgaggacggcgacatc
tggctgctcggccgggtggacgacgtgatgaacgtctccggccaccgcctgtcgaccgcg
gagatcgagtcctccctcgtcgcgcacccgtacgtcgccgaggctgcggtcgtcggcgcg
tccgacgaggcgaccggccaggcggtcgtggccttcgtgatcctccgctcggccgaggcg
atcgcgctcggcgacgaggacccgaacgaggtcctccggaagcacgtctccgaccagatc
ggcgccatcgcgaagccgcgtcgcgtgttcgtggtgcatgagctgccgaagacgcgctcg
ggcaagatcatgcgccggctgctgcgcgacgtggcggagggccgggcgatcggcgacacc
accacgctggcggacacacaggtgatgcacgtcatctccgaccgcatgagcgcgggctga

DBGET integrated database retrieval system