KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_0932Help
Entry
CMM_0932          CDS       T00529                                 

Gene name
pncA
Definition
putative pyrazinamidase / nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CMM_0932 (pncA)
Enzymes [BR:cmi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     CMM_0932 (pncA)
    3.5.1.-  
     CMM_0932 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1074759..1075349
Genome map
AA seq 196 aa AA seqDB search
MSRALFIIDVQNDFTEGGALGVDGGGDVARGITRLLAAEPYRYDHVLASRDWHEATGDNG
GHFAAAGVVPDFSTTWPSHCVQGTHGAEYHPDLDVTAVDFHLRKGQGAPAYSIFEGTTED
GVPLADLLALHDITDIDVVGLATDYCVLASALDAVHQGKRVRILADLVAGVAPATSAAAL
DRLRDAGAEIVEGAAD
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtgctctgttcatcatcgacgtgcagaacgacttcacggagggcggcgcgctc
ggcgtcgacggcggcggcgacgtcgcacggggtatcacccggctcctcgccgcggagccg
taccggtacgaccacgtcctcgcgtcgcgcgactggcacgaggcgacgggcgacaacggc
gggcacttcgccgcggccggcgtcgtccccgacttctcgaccacgtggccctcgcactgc
gtgcagggcacccacggcgccgagtaccaccccgacctcgacgtcaccgccgtcgacttc
cacctccgcaagggccagggcgcgcccgcctactcgatcttcgagggcacgacggaggac
ggcgtgccgctggcggacctgctggcgctgcacgacatcacggacatcgacgtcgtcggc
ctcgcgaccgactactgcgtgctcgcctcggcgctcgacgcggtgcaccagggcaagcgg
gtgcggatcctcgccgacctcgtcgcgggcgtggcgccggccaccagcgccgccgcgctc
gaccgcctccgcgacgccggggccgagatcgtcgagggcgcggccgactag

DBGET integrated database retrieval system