KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_0942Help
Entry
CMM_0942          CDS       T00529                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CMM_0942
Enzymes [BR:cmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CMM_0942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1084888..1085718
Genome map
AA seq 276 aa AA seqDB search
MPMGRVMVLGSLNVDQVVRVPRHPQPGETLIGSDPERLWGGKGANQAVAAADAGGEVAMV
GAVGDDADGSAYRARLEDRGIDVSGLVTVDDATTGLAIIAVDDDGENTIIVAPGANARVT
DAHLDPLDALATGDVLLASLELPLDTVAAGVRRAHAAGARVVLNLAPFAALPADVLALAD
PVVVNEHEAALLRESGTPAPASLLVTLGAEGAVWGDVEVPASHVSRVVDTTGAGDAFCGA
LASALAAGADREGALVVAADAAAVVVQRQGAQPADD
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtgcccatgggccgcgtcatggtgctcggatcgctcaacgtcgaccaggtggtgcgcgtc
ccgcggcacccgcagccgggggagacgctcatcggatccgaccccgagcggctctggggc
ggcaagggcgcgaaccaggcggtcgccgcggccgacgccggcggcgaggtcgcgatggtg
ggggccgtgggcgacgacgccgacggatccgcgtaccgcgcgcgcctcgaggaccgcggc
atcgacgtgtccggcctcgtcaccgtggacgacgccacgacgggcctcgcgatcatcgcg
gtggacgacgacggcgagaacacgatcatcgtcgcgcccggcgccaacgcccgcgtcacc
gacgcccacctggatccgctcgacgcgctcgccacgggcgacgtcctcctcgcctcgctc
gagctgcccctcgacaccgtggccgcgggcgtccgccgcgcgcacgccgccggcgcccgc
gtcgtgctgaacctcgcgcccttcgcggcgctgcccgccgacgtgctcgcgctcgcggat
cccgtcgtcgtcaacgagcacgaggccgcgctcctccgagagtcgggcacgcccgcaccg
gcgtcgctgctcgtcacgctgggcgccgagggcgccgtgtggggcgacgtcgaggtcccc
gcgtcccacgtctcccgcgtcgtcgacaccaccggtgcgggcgacgcgttttgcggggcg
ctggcctcggcgctcgccgcgggcgccgaccgagagggcgccctggtcgtcgccgccgac
gcggccgcggtcgtcgtgcagcggcagggcgcgcagccggcggacgactga

DBGET integrated database retrieval system