KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_0971Help
Entry
CMM_0971          CDS       T00529                                 

Gene name
sdhD
Definition
putative succinate dehydrogenase, hydrophobic membrane subunit (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CMM_0971 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CMM_0971 (sdhD)
   00650 Butanoate metabolism
    CMM_0971 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    CMM_0971 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1116493..1116957)
Genome map
AA seq 154 aa AA seqDB search
MSDIAQQVSVERPRQPRQPRKQGGVNWEKWGWMYMRASGVVLVVLIFGHLYVNLIQGEGI
KAIDFAFVGGKLSDPFWKVWDIALLWLAVIHGANGMRTLVNDYAASPRTRTILKGALVTS
TVVLLVLGTLVVFTFDPCPAGQPADLLPSFCGDL
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcgcacagcaggtcagcgtcgagcgcccccgccagccgcgccagccccgc
aagcagggcggcgtgaactgggagaagtggggctggatgtacatgcgcgcctcgggcgtc
gtgctcgtcgtgctcatcttcggccacctctacgtcaacctcatccagggcgagggcatc
aaggccatcgacttcgcgttcgtcggcggcaagctgtccgacccgttctggaaggtgtgg
gacatcgcgctgctctggctcgcggtcatccacggcgccaacggcatgcgcaccctcgtg
aatgactacgccgcgtcaccgcgcacccgcacgatcctcaagggcgcgctcgtcacgtcc
acggtggtcctgctcgtgctcggcacgctcgtggtcttcacgttcgacccgtgccccgcc
ggtcagcccgccgacctgctgccctccttctgcggcgacctctag

DBGET integrated database retrieval system