KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_0981Help
Entry
CMM_0981          CDS       T00529                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cmi00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1127064..1128362
Genome map
AA seq 432 aa AA seqDB search
MSAAFDVVDLIRTKRDGGRLSTAEIDWLVAAYTDRYVADEQMAALAMAILLRGMDRAEIR
DLTLAMIASGETLDFSQLGKPTVDKHSTGGVGDKITLPLMPLVASYGVAVPQLSGRGLGH
TGGTLDKLESIPGWRADLSTEEMVRQMQDHGGVICAAGSGLAPADKRLYALRDTTGTVEA
IPLIASSIMSKKIAEGTGALVLDVKFGSGAFMTDIDRSRELARTMVELGTDAGVRTTALL
TDMDVPLGLAIGNANEVRESVEVLAGGGPADVVELTLALAREMLAAVGIPDADVEVALRD
GRAMDAWRATVRAQGGDPDAAMPVARETHVVTAERDGVLVQQDALPFGIAAWRLGAGRAR
QGDAVQHAAGVDLHAKPGDRVRRGDPLFTLSTDEPERFARALESLEGAYRVGDPEEHVAR
GPLVRERITAEG
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccgcgttcgacgtcgtcgacctgatccgcaccaagcgcgacggcggacgcctc
tcgaccgccgagatcgactggctcgtggcggcgtacaccgaccgctacgtggcggacgag
cagatggccgcgctcgcgatggcgatcctgctccgcggcatggaccgcgccgagatccgc
gacctgacgctcgcgatgatcgccagcggcgagacgctcgacttctcgcagctcgggaag
cccacggtcgacaagcactccacgggcggcgtgggcgacaagatcaccctcccgctcatg
ccgctggtcgcctcctacggcgtcgcggtgccgcagctctcgggccgcggcctcggccac
acgggcggcacgctcgacaagctcgagtcgatccccggctggcgtgccgacctctcgacg
gaggagatggtgcgccagatgcaggaccacggcggcgtgatctgcgcggccggcagcggc
ctcgcaccggcggacaagcgcctctatgcgctccgcgacaccaccggcacggtcgaggcg
atcccgctcatcgcctcgagcatcatgagcaagaagatcgccgagggcacgggcgcgctc
gtgctcgacgtgaagttcggatccggcgccttcatgaccgacatcgaccggtcgcgcgag
ctcgcgcgcaccatggtcgagctcggcaccgacgccggggtgcggaccaccgcgctcctc
accgacatggacgtgcccctcgggctcgccatcggcaacgccaacgaggtgcgcgagtcc
gtcgaggtgctcgcgggcggcggccccgccgacgtcgtggagctcacgctggcgctcgcg
cgggagatgctcgccgcggtcgggatccccgacgccgacgtcgaggtcgccctccgcgac
ggccgggccatggacgcgtggcgcgccaccgtgcgcgcgcagggcggggacccggacgcc
gcgatgcccgtggcgcgcgagacccatgtggtcaccgcggagcgcgacggcgtgctcgtg
cagcaggacgccctcccgttcggcatcgccgcctggcgcctcggcgccggacgcgcgcgc
cagggcgacgccgtgcagcacgccgcgggcgtcgacctgcacgccaagccgggggaccgc
gtccgccgcggcgacccgctgttcacgctctccaccgacgagcccgagcggttcgcccgc
gcgctggagtcgctcgagggcgcgtaccgcgtcggcgatccggaggagcacgtcgcgcgc
ggcccgctcgtgcgggagcgcatcaccgccgagggctga

DBGET integrated database retrieval system