KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_0981Help
Entry
CMM_0981          CDS       T00529                                 

Gene name
deoA
Definition
(GenBank) thymidine phosphorylase (NP_824541.1| putative thymidine phosphorylase [Streptomyces avermitilis MA-4680]; ZP_00226024.1| COG0213: Thymidine phosphorylase [Kineococcus radiotolerans SRS30216]). THE ENZYMES WHICH CATALYZE THE REVERSIBLE PHOSPHORYLOSIS OF PYRIMIDINE NUCLEOSIDES ARE INVOLVED IN THE DEGRADATION OF THESE COMPOUNDS AND IN THEIR UTILIZATION AS CARBON AND ENERGY SOURCES OR IN THE RESCUE OF PYRIMIDINE BASES FOR NUCLEOTIDE SYNTHESIS. pfam02885, Glycos_trans_3N, Glycosyl transferase family, helical bundle domain. pfam00591,Glycos_transf_3, Glycosyl transferase family, a/b domain. This family includes anthranilate phosphoribosyltransferase (TrpD), thymidine phosphorylase. All these proteins can transfer a phosphorylated ribose substrate.; High confidence in function and specificity (EC:2.4.2.4)
  KO
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CMM_0981 (deoA)
Enzymes [BR:cmi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     CMM_0981 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1127064..1128362
Genome map
AA seq 432 aa AA seqDB search
MSAAFDVVDLIRTKRDGGRLSTAEIDWLVAAYTDRYVADEQMAALAMAILLRGMDRAEIR
DLTLAMIASGETLDFSQLGKPTVDKHSTGGVGDKITLPLMPLVASYGVAVPQLSGRGLGH
TGGTLDKLESIPGWRADLSTEEMVRQMQDHGGVICAAGSGLAPADKRLYALRDTTGTVEA
IPLIASSIMSKKIAEGTGALVLDVKFGSGAFMTDIDRSRELARTMVELGTDAGVRTTALL
TDMDVPLGLAIGNANEVRESVEVLAGGGPADVVELTLALAREMLAAVGIPDADVEVALRD
GRAMDAWRATVRAQGGDPDAAMPVARETHVVTAERDGVLVQQDALPFGIAAWRLGAGRAR
QGDAVQHAAGVDLHAKPGDRVRRGDPLFTLSTDEPERFARALESLEGAYRVGDPEEHVAR
GPLVRERITAEG
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccgcgttcgacgtcgtcgacctgatccgcaccaagcgcgacggcggacgcctc
tcgaccgccgagatcgactggctcgtggcggcgtacaccgaccgctacgtggcggacgag
cagatggccgcgctcgcgatggcgatcctgctccgcggcatggaccgcgccgagatccgc
gacctgacgctcgcgatgatcgccagcggcgagacgctcgacttctcgcagctcgggaag
cccacggtcgacaagcactccacgggcggcgtgggcgacaagatcaccctcccgctcatg
ccgctggtcgcctcctacggcgtcgcggtgccgcagctctcgggccgcggcctcggccac
acgggcggcacgctcgacaagctcgagtcgatccccggctggcgtgccgacctctcgacg
gaggagatggtgcgccagatgcaggaccacggcggcgtgatctgcgcggccggcagcggc
ctcgcaccggcggacaagcgcctctatgcgctccgcgacaccaccggcacggtcgaggcg
atcccgctcatcgcctcgagcatcatgagcaagaagatcgccgagggcacgggcgcgctc
gtgctcgacgtgaagttcggatccggcgccttcatgaccgacatcgaccggtcgcgcgag
ctcgcgcgcaccatggtcgagctcggcaccgacgccggggtgcggaccaccgcgctcctc
accgacatggacgtgcccctcgggctcgccatcggcaacgccaacgaggtgcgcgagtcc
gtcgaggtgctcgcgggcggcggccccgccgacgtcgtggagctcacgctggcgctcgcg
cgggagatgctcgccgcggtcgggatccccgacgccgacgtcgaggtcgccctccgcgac
ggccgggccatggacgcgtggcgcgccaccgtgcgcgcgcagggcggggacccggacgcc
gcgatgcccgtggcgcgcgagacccatgtggtcaccgcggagcgcgacggcgtgctcgtg
cagcaggacgccctcccgttcggcatcgccgcctggcgcctcggcgccggacgcgcgcgc
cagggcgacgccgtgcagcacgccgcgggcgtcgacctgcacgccaagccgggggaccgc
gtccgccgcggcgacccgctgttcacgctctccaccgacgagcccgagcggttcgcccgc
gcgctggagtcgctcgagggcgcgtaccgcgtcggcgatccggaggagcacgtcgcgcgc
ggcccgctcgtgcgggagcgcatcaccgccgagggctga

DBGET integrated database retrieval system