KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_1012Help
Entry
CMM_1012          CDS       T00529                                 

Gene name
rmlC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:cmi00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:cmi00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1157747..1158352
Genome map
AA seq 201 aa AA seqDB search
MQIRELAVPDGYEITPVQRADDRGVFLEWYRFDELERVVGHRLDLRQANMSVSKRGVVRG
VHFADVPRGQAKYVKAVSGAVLDFVIDIRVGSPTFGQWDSVRLDTETHKAVYISEGLGHC
FVALTDDAAVTYLVSDVYNPGAEHGITPLDPELGLVFPEEAGEALLSPKDLEAPTLAEAA
AAGLLPTWSDMRAFHDSQKVS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgcagatccgagagctcgccgtgcccgacggctacgagatcacccccgtccagcgcgcc
gacgaccggggcgtgttcctcgagtggtaccggttcgacgagctcgagcgggtcgtcgga
caccggctggacctgcgccaggccaacatgagcgtctccaagcgcggcgtcgtccgcggc
gtgcacttcgccgacgtgccgcgcggccaggccaagtacgtgaaggccgtctccggcgcc
gtgctcgacttcgtcatcgacatccgcgtcggatccccgaccttcgggcagtgggacagc
gtgcggctcgacaccgagacgcacaaggccgtctacatctccgagggcctcggccactgc
ttcgtcgcgctcaccgacgacgcggccgtcacctacctcgtgagcgacgtctacaacccc
ggcgccgagcacgggatcacgccgctcgaccccgagctcgggctcgtgttccccgaggag
gccggcgaggcgctcctctccccgaaggacctcgaggccccgacgctcgccgaggcggcg
gccgccggactcctccccacctggtcggacatgcgcgccttccacgactcgcagaaggtg
agctga

DBGET integrated database retrieval system