KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_1359Help
Entry
CMM_1359          CDS       T00529                                 

Gene name
fpgA
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    CMM_1359 (fpgA)
Enzymes [BR:cmi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     CMM_1359 (fpgA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     CMM_1359 (fpgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1537792..1538727
Genome map
AA seq 311 aa AA seqDB search
MPELPEVEVVRAGLEPAVAGARITGVEILDARSLKRHDPLEGAFVDLLVGRVITSAVRRG
KFMWLPLEPDPGRDATGPRALVTHLGMSGQVLLREPGSDPDGLLRIRMGIEHPVHGELVV
AFVDQRIFGSMAVDRLVPTPDGHAGGRGSDAASVPTQVAHIARDPLDPAFDDELLLDRLA
RRRTGIKRALLDQTLVSGIGNIYADEALWAARIHYAHPTDALARGRALRLLAEVRQVLAR
ALAEGGTSFDAQYVNVNGASGYFSHSLNAYGQQGRPCPRCGTPIVREAFMNRGSHLCPRC
QVLPDPDAAAA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagctccccgaggtcgaggtcgtccgcgccggcctggagcccgcggtcgccggc
gcgcgcatcaccggcgtcgagatcctcgacgcgcgctccctcaagcggcacgatccgctc
gagggcgcgttcgtcgacctgctcgtcggccgcgtgatcacctcggccgtccgccgcggc
aagttcatgtggctgccgctcgagcccgaccccggtcgcgacgccaccgggcctcgcgcc
ctcgtcacgcacctcggcatgagcgggcaggtgctcctccgggagcccggctccgacccg
gacggcctgctgcggatccgcatgggcatcgagcaccccgtgcacggcgagctggtggtc
gccttcgtcgaccagcggatcttcggctcgatggccgtcgaccgcctcgtgccgacgccc
gacgggcatgcgggcggccgcggatccgacgccgcgtccgtgccgacgcaggtcgcccac
atcgcgcgcgatcccctcgacccggcgttcgacgacgagctgctgctcgaccgcctggcc
cggcggcgaaccgggatcaagcgcgcgctgctcgaccagacgctcgtgagcggcatcggc
aacatctacgcggacgaggcgctgtgggccgcgcggatccactacgcgcaccccaccgac
gccctcgctcgcggtcgcgcgctgcgcctcctcgccgaggtgcgccaggtgctcgcgcgg
gctctggccgagggcggcacgagcttcgacgcgcagtacgtcaacgtcaacggcgcgtcc
ggctacttctcccattcgctcaacgcctacggccagcaggggaggccgtgcccgcgctgc
ggcacgccgatcgtccgcgaggccttcatgaaccgcggctcgcacctctgcccgcggtgc
caggtgctgccggatccggacgcggcggccgcctga

DBGET integrated database retrieval system