KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_1359Help
Entry
CMM_1359          CDS       T00529                                 

Gene name
fpgA
Definition
(GenBank) Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23) ((ZP_00059097.1| COG0266: Formamidopyrimidine-DNA glycosylase [Thermobifida fusca]; ZP_00228404.1| COG0266: Formamidopyrimidine-DNA glycosylase [Kineococcus radiotolerans SRS30216]). This enzyme may play a significant role in processes leading to recovery from mutagenesis and/or cell death by alkylating agents. Also involved in the go system responsible for removing an oxidatively damaged form of guanine (78-dihydro-8-oxoguanine = 7-OxoG) from DNA. Can also nick DNA at apurinic/apyrimidinic sites (AP sites) (By similarity). fpg: formamidopyrimidine-DNA glycosylas pfam01149,Fapy_DNA_glyco, Formamidopyrimidine-DNA glycosylase N-terminal domain. pfam06831, H2TH, Formamidopyrimidine-DNA glycosylase H2TH domain. pfam06827, zf-FPG_IleRS, Zinc finger found in FPG and IleRS.; High confidence in function and specificity (EC:3.2.2.23)
  KO
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    CMM_1359 (fpgA)
Enzymes [BR:cmi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     CMM_1359 (fpgA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     CMM_1359 (fpgA)
DNA repair and recombination proteins [BR:cmi03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     CMM_1359 (fpgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1537792..1538727
Genome map
AA seq 311 aa AA seqDB search
MPELPEVEVVRAGLEPAVAGARITGVEILDARSLKRHDPLEGAFVDLLVGRVITSAVRRG
KFMWLPLEPDPGRDATGPRALVTHLGMSGQVLLREPGSDPDGLLRIRMGIEHPVHGELVV
AFVDQRIFGSMAVDRLVPTPDGHAGGRGSDAASVPTQVAHIARDPLDPAFDDELLLDRLA
RRRTGIKRALLDQTLVSGIGNIYADEALWAARIHYAHPTDALARGRALRLLAEVRQVLAR
ALAEGGTSFDAQYVNVNGASGYFSHSLNAYGQQGRPCPRCGTPIVREAFMNRGSHLCPRC
QVLPDPDAAAA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagctccccgaggtcgaggtcgtccgcgccggcctggagcccgcggtcgccggc
gcgcgcatcaccggcgtcgagatcctcgacgcgcgctccctcaagcggcacgatccgctc
gagggcgcgttcgtcgacctgctcgtcggccgcgtgatcacctcggccgtccgccgcggc
aagttcatgtggctgccgctcgagcccgaccccggtcgcgacgccaccgggcctcgcgcc
ctcgtcacgcacctcggcatgagcgggcaggtgctcctccgggagcccggctccgacccg
gacggcctgctgcggatccgcatgggcatcgagcaccccgtgcacggcgagctggtggtc
gccttcgtcgaccagcggatcttcggctcgatggccgtcgaccgcctcgtgccgacgccc
gacgggcatgcgggcggccgcggatccgacgccgcgtccgtgccgacgcaggtcgcccac
atcgcgcgcgatcccctcgacccggcgttcgacgacgagctgctgctcgaccgcctggcc
cggcggcgaaccgggatcaagcgcgcgctgctcgaccagacgctcgtgagcggcatcggc
aacatctacgcggacgaggcgctgtgggccgcgcggatccactacgcgcaccccaccgac
gccctcgctcgcggtcgcgcgctgcgcctcctcgccgaggtgcgccaggtgctcgcgcgg
gctctggccgagggcggcacgagcttcgacgcgcagtacgtcaacgtcaacggcgcgtcc
ggctacttctcccattcgctcaacgcctacggccagcaggggaggccgtgcccgcgctgc
ggcacgccgatcgtccgcgaggccttcatgaaccgcggctcgcacctctgcccgcggtgc
caggtgctgccggatccggacgcggcggccgcctga

DBGET integrated database retrieval system