KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_1397Help
Entry
CMM_1397          CDS       T00529                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CMM_1397 (glgB)
Enzymes [BR:cmi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CMM_1397 (glgB)
Exosome [BR:cmi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CMM_1397 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1576974..1579553)
Genome map
AA seq 859 aa AA seqDB search
MTDTTPQDDPQDPQGELPGADVIVPPAADADIEQGADVVVPAEDGAADEAPASASASASG
PIRLPEVADDDLRAVAEGVHSGPHSVLGQHPVAIDGVDDDLVVVRALRPLAEAVSVILST
GARVALAHVAHGVWQGAHVLGLQDYQVEARYSDGGTWTSDDPYRFLPTVGDLDLYLFGEG
RHERLWDVLGAHHREHWGVAQTYWGVSFSVWAPHARAVRVIGGFNGWDGVQHAMRRLDGN
GVWELFVPGVEPGVSYKFEILTQAGQWIEKADPMARMTEVPPATASRVETSGYQWDDAAW
LEERAARDPHDSPMSVYEMHLGSWRPGLGYREVAGELVAYLQELSYTHVEFLPLAEHPFG
GSWGYQVSGYYAPTSRFGSPDDLKFLIDSLHRAGIGVIVDWVPAHFPKDAFALAQFDGQP
LYEHTDPRRGEQQDWGTLVFDFGHSQVRNFLVANALYWFEEFHIDGLRVDAVASMLYLDY
SREEGQWLPNVHGGRENLEAISFLQEVNATAYRTHPGIVMIAEESTSFPGVTRPTSDGGL
GFGLKWNMGWMHDTLDYAAEDPMYRSYHHGQITFSMVYAYTENFLLPISHDEVVHGKGSL
VGKMPGDHWQKLANVRAYLSFMWSHPGKQLLFMGQEFGQPSEWSEERGLDWWILDQPVHR
ALFDLVGSLNRTYIDTPALWALDNDPAGFEWIDAGDAGRNVLAFLRRDREGNQVAVVHNF
SGAPIQGYRLGLPQAGVWEEILNTDAEQFGGSGVGNLGAVHAGDEGWHGRPASAELTLPP
LAGLWLRMKQDPADLRPVEAPAHAAPDADESRADGTPFAEPDALPVLPQSPDAQPPVEGL
STTDDAPGSDDGTPRVPTV
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaccaccccccaggacgacccgcaggacccccagggcgagctgcccggcgcc
gacgtgatcgtgccgccggccgccgacgccgacatcgagcagggcgccgacgtggtcgtg
cccgccgaggacggcgcggcggacgaggcgcccgcctccgcgtccgcatccgcctccggc
cccatccgcctccccgaggtcgccgacgacgatctgcgcgccgtcgccgagggcgtccac
tccggacctcactcggtcctcggccagcaccccgtcgcgatcgacggcgtcgacgacgac
ctcgtcgtcgtccgcgcgctccgccccctggcggaggccgtgtccgtgatcctctccacc
ggcgcccgcgtcgcgctcgcccacgtggcccacggcgtctggcagggcgcgcacgtgctc
ggcctgcaggactaccaggtcgaggcgcgctactccgacggcggcacctggacgagcgac
gacccgtaccgcttcctcccgaccgtgggcgacctcgacctctacctcttcggcgagggc
cgccacgagcgcctctgggacgtcctcggcgcgcaccaccgggagcactggggcgtcgcg
cagacgtactggggcgtctccttctcggtctgggcgccgcacgcccgcgccgtccgcgtc
atcggcggcttcaacggctgggacggcgtgcagcacgcgatgcgccgcctcgacgggaac
ggcgtctgggagctcttcgtgccgggcgtcgagccgggcgtctcgtacaagttcgagatc
ctcacgcaggccgggcagtggatcgagaaggccgaccccatggcccgcatgaccgaggtc
cctccggcgaccgcgtcgcgcgtcgagacgagcggctaccagtgggacgacgccgcctgg
ctcgaggagcgggccgcgcgcgacccgcacgactcccccatgagcgtgtacgagatgcac
ctcggatcctggcgtcccggcctcggctaccgcgaggtcgccggcgagctcgtcgcctac
ctccaggagctctcctacacgcacgtcgagttcctgccgctcgcggagcacccgttcggc
gggtcctggggctaccaggtctccggctactacgcgcccacgtcgcgcttcggatccccc
gacgacctcaagttcctcatcgactcgctgcaccgcgccggcatcggcgtcatcgtcgac
tgggtcccggcgcacttcccgaaggacgccttcgcgctcgcgcagttcgacggccagccg
ctgtacgagcacacggatccccgccgcggcgagcagcaggactggggcacgctcgtcttc
gacttcggccactcgcaggtgcggaacttcctcgtcgcgaacgcgctgtactggttcgag
gagttccacatcgacggcctccgggtcgacgccgtggcctcgatgctgtacctcgactac
tcgcgcgaggagggccagtggctccccaacgtgcacggcggccgcgagaacctcgaggcg
atcagcttcctgcaggaggtcaacgccaccgcgtaccgcacccaccccggcatcgtgatg
atcgcggaggagtccacgagcttccccggcgtcacgcgccccacgagtgacggcggcctc
ggcttcggcctcaagtggaacatgggctggatgcacgacaccctcgactacgcagccgag
gacccgatgtaccgctcgtaccaccacggccagatcacgttctcgatggtctacgcgtac
acggagaacttcctcctccccatcagccacgacgaggtcgtgcacggcaagggatcgctc
gtcggcaagatgccgggcgaccactggcagaagctcgccaacgtgcgcgcctacctctcg
ttcatgtggtcgcaccccggcaagcagctgctcttcatgggtcaggagttcgggcagccg
tccgagtggagcgaggagcgcgggctcgactggtggatcctcgaccagcccgtgcaccgc
gccctcttcgacctcgtcgggtcgctcaaccgcacctacatcgacacgcccgcgctgtgg
gcgctcgacaacgacccggccggcttcgagtggatcgacgcgggcgacgccgggcgcaac
gtgctcgcgttcctccgccgcgaccgcgaggggaaccaggtcgccgtcgtgcacaacttc
tccggggcgcccatccagggctaccggctggggctgccgcaggcgggcgtgtgggaggag
atcctcaacacggacgccgagcagttcggcggatcgggcgtgggcaacctcggcgccgtg
cacgcgggcgacgagggctggcacggccggcccgcgtcggcggagctgacgctgccgccg
ctcgcgggcctctggctgcgcatgaagcaggacccggccgacctccgccccgtcgaggcg
cccgcgcacgcggcacccgacgcggacgagtcgcgcgccgacggcacgccgttcgccgag
ccggacgccctgcccgtgctgccgcagtcgcccgacgcgcagccgccggtcgaggggctg
tccacgacggacgacgcgcccggctccgacgacggcaccccgcgggtgcccacggtctga

DBGET integrated database retrieval system