KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_1509Help
Entry
CMM_1509          CDS       T00529                                 

Gene name
hisC1
Definition
histidinol-phosphate aminotransferase (EC:2.6.1.9)
Orthology
K00817  
histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CMM_1509 (hisC1)
  Amino acid metabolism
   00340 Histidine metabolism
    CMM_1509 (hisC1)
   00350 Tyrosine metabolism
    CMM_1509 (hisC1)
   00360 Phenylalanine metabolism
    CMM_1509 (hisC1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CMM_1509 (hisC1)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    CMM_1509 (hisC1)
Enzymes [BR:cmi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     CMM_1509 (hisC1)
Amino acid related enzymes [BR:cmi01007]
 Aminotransferase (transaminase)
  Class II
   CMM_1509 (hisC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1709966..1711084)
Genome map
AA seq 372 aa AA seqDB search
MSPDWSETTLADLPLRDGIRGEEPYGAPQLDVPVLLNVNENPYPLPEEVAVAVSEAVLEA
ARGLNRYPDREFLELRTELADYLTADSGLELGPENVWAANGSNEVLQQVLQAFGGTDRVA
LSFAPHYAMYPEYARNTLTRWVSGRRQEDFTLDLANVTALVEQHQPSVVFLTSPNNPTGT
ALTIPEIEHVLSVAPGVVVIDEAYAEFRREGVPTAISLLPDNPRLIVSRTMSKAFAFAGG
RLGYLAASPAVVDALRIVRLPYHLSRITQVSATAALRHSGVLLAQVASLREERDALVEWL
RGRGFEVAPSDANFVLFGRFPDRHAVWQGLLDRGVLIRETGPEGWLRVSVGTPEETAAFR
DALDDVLGTPRG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgagccccgactggtccgagaccaccctcgccgacctgcccctccgcgacgggatccgc
ggcgaggagccctacggcgccccgcagctcgacgtgcccgtgctcctcaacgtgaacgag
aacccgtacccgctgcccgaggaggtcgcggtggccgtgagcgaggccgtgctcgaggcc
gcgcgggggctcaaccgctacccggaccgcgagttcctggagctccgcaccgagctcgcg
gactacctcacggcggacagcggcctggagctcgggccggagaacgtctgggcggcgaac
ggatccaacgaggtgctgcagcaggtgctccaggccttcggcggcaccgaccgcgtcgcc
ctctcgttcgcgccgcactacgcgatgtacccggagtacgcgcgcaacacgctcacgcgc
tgggtctcggggcgccgccaggaggacttcacgctcgacctcgcgaacgtcacggcgctc
gtcgagcagcaccagccgagcgtcgtgttcctcacctcgccgaacaaccccacgggcacc
gcgctcacgatccccgagatcgagcacgtgctctcggtcgcccccggcgtcgtggtgatc
gacgaggcctacgccgagttccgtcgcgagggcgtgccgacggcgatctcgctgctcccc
gacaacccgcgcctgatcgtgtcgcgcaccatgagcaaggcgttcgccttcgcgggcggc
cggctcgggtacctcgcggcgtcccccgcggtcgtcgacgcgctccggatcgtgcgcctg
ccgtaccacctgtcccggatcacgcaggtgagcgcgaccgccgccctccggcacagcggg
gtgctgctcgcgcaggtcgcgtcgctgcgcgaggagcgggacgcgctcgtcgagtggctg
cgcggccgcggcttcgaggtggcgccctcggacgcgaacttcgtgctcttcggccggttc
cccgatcgccacgcggtgtggcaggggctgctcgaccgcggcgtcctgatccgcgagacc
ggacccgagggctggctccgggtctccgtcggcacccccgaggagacggccgcgttccgc
gacgcgctcgacgacgtgctcgggacgccgcggggctga

DBGET integrated database retrieval system