KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_1509Help
Entry
CMM_1509          CDS       T00529                                 

Gene name
hisC1
Definition
histidinol-phosphate aminotransferase (EC:2.6.1.9)
Orthology
K00817  
histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cmi01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cmi00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:cmi00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:cmi00360]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cmi00400]
Metabolism; Biosynthesis of other secondary metabolites; Novobiocin biosynthesis [PATH:cmi00401]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1709966..1711084)
Genome map
AA seq 372 aa AA seqDB search
MSPDWSETTLADLPLRDGIRGEEPYGAPQLDVPVLLNVNENPYPLPEEVAVAVSEAVLEA
ARGLNRYPDREFLELRTELADYLTADSGLELGPENVWAANGSNEVLQQVLQAFGGTDRVA
LSFAPHYAMYPEYARNTLTRWVSGRRQEDFTLDLANVTALVEQHQPSVVFLTSPNNPTGT
ALTIPEIEHVLSVAPGVVVIDEAYAEFRREGVPTAISLLPDNPRLIVSRTMSKAFAFAGG
RLGYLAASPAVVDALRIVRLPYHLSRITQVSATAALRHSGVLLAQVASLREERDALVEWL
RGRGFEVAPSDANFVLFGRFPDRHAVWQGLLDRGVLIRETGPEGWLRVSVGTPEETAAFR
DALDDVLGTPRG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgagccccgactggtccgagaccaccctcgccgacctgcccctccgcgacgggatccgc
ggcgaggagccctacggcgccccgcagctcgacgtgcccgtgctcctcaacgtgaacgag
aacccgtacccgctgcccgaggaggtcgcggtggccgtgagcgaggccgtgctcgaggcc
gcgcgggggctcaaccgctacccggaccgcgagttcctggagctccgcaccgagctcgcg
gactacctcacggcggacagcggcctggagctcgggccggagaacgtctgggcggcgaac
ggatccaacgaggtgctgcagcaggtgctccaggccttcggcggcaccgaccgcgtcgcc
ctctcgttcgcgccgcactacgcgatgtacccggagtacgcgcgcaacacgctcacgcgc
tgggtctcggggcgccgccaggaggacttcacgctcgacctcgcgaacgtcacggcgctc
gtcgagcagcaccagccgagcgtcgtgttcctcacctcgccgaacaaccccacgggcacc
gcgctcacgatccccgagatcgagcacgtgctctcggtcgcccccggcgtcgtggtgatc
gacgaggcctacgccgagttccgtcgcgagggcgtgccgacggcgatctcgctgctcccc
gacaacccgcgcctgatcgtgtcgcgcaccatgagcaaggcgttcgccttcgcgggcggc
cggctcgggtacctcgcggcgtcccccgcggtcgtcgacgcgctccggatcgtgcgcctg
ccgtaccacctgtcccggatcacgcaggtgagcgcgaccgccgccctccggcacagcggg
gtgctgctcgcgcaggtcgcgtcgctgcgcgaggagcgggacgcgctcgtcgagtggctg
cgcggccgcggcttcgaggtggcgccctcggacgcgaacttcgtgctcttcggccggttc
cccgatcgccacgcggtgtggcaggggctgctcgaccgcggcgtcctgatccgcgagacc
ggacccgagggctggctccgggtctccgtcggcacccccgaggagacggccgcgttccgc
gacgcgctcgacgacgtgctcgggacgccgcggggctga

DBGET integrated database retrieval system