KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_1641Help
Entry
CMM_1641          CDS       T00529                                 

Gene name
aceF
Definition
putative pyruvate/2-oxoglutarate dehydrogenase complex dihydrolipoamide acyltransferase (E2) component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CMM_1641 (aceF)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CMM_1641 (aceF)
  Amino acid metabolism
   00310 Lysine degradation
    CMM_1641 (aceF)
Enzymes [BR:cmi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CMM_1641 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1855324..1856766)
Genome map
AA seq 480 aa AA seqDB search
MSESVNLPALGESVTEGTVTRWLKNVGDHVEVDEPLLEVSTDKVDTEIPSPVAGVIEEIL
VQEDETVEVGAVLVRIGDGSGGGDAPAEEPAAAAEPETATEEPAEDTVIPSTEGDDDAEA
PAPVEPEPAPAAEAETPAPATPPAPAPAAPAPVAAAPAPAPAAPTPAAAPAPAASGNAGY
VTPLVRKLANERGVDIGSVTGTGVGGRIRKEDVLAAAEAAASKSAPTASAPAAPAAAPLE
TSPLRGTTAKMSRMRKLIADRAVVSMQSTAQLTSVVEVDVTKVARFRDRVKGDFLEKTGV
KLSFLPFFALAAAEALKAYPVVNATVDGDSIVYPDHENISIAVDTERGLLTPVVKNAEGK
NLAQFASEIADLAARTRDNKLSPDELAGGTFTLTNTGSRGALFDTPVVFLPQSAILGTGI
VTKRPVVITADGQDTIAIRSTVYLALSYDHRIVDGADASRFLVAVKNRLEAGAFDADLGI
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatccgtcaacctccccgcactcggcgagagcgtcaccgagggcacggtgacc
cgttggctcaagaacgtcggcgaccacgtcgaggtcgacgagcccctgctcgaggtgtcg
accgacaaggtcgacaccgagatcccctcgccggtcgccggcgtgatcgaggagatcctc
gtccaggaggacgagaccgtcgaggtgggcgccgtgctggtgcgcatcggcgacggctcc
ggtggcggcgacgcgcccgcggaggagcccgccgccgcagcggagccggagacggcgacc
gaggagcccgccgaggacaccgtgatcccctccaccgagggggacgacgacgccgaggcg
cctgctcccgtcgagcccgagccggccccggccgctgaggcggagacgcccgctcccgcg
acgcccccggcacccgctcccgccgctcctgctcctgtcgccgctgctccggcgcccgct
cctgcagctccgacgcccgccgccgccccggctcctgctgcgtccggcaacgcgggctac
gtcaccccgctggtgcgcaagctcgccaacgagcggggggtcgacatcggctccgtgacc
ggcaccggtgtgggagggcgcatccgcaaggaggacgtgctcgccgctgccgaggccgcc
gcgtcgaagagcgccccgaccgcctcggctcccgcggcgcccgccgccgctccgctcgag
acgtcgccgctccgtggcacgaccgcgaagatgtcccgcatgcgcaagctcatcgccgac
cgcgctgtggtctcgatgcagtccaccgcgcagctcacctcggtggtcgaggtcgacgtc
acgaaggtggcccgcttccgcgaccgcgtgaagggcgacttcctcgagaagacgggcgtc
aagctctcgttcctgcccttcttcgcactcgccgccgctgaggcgctcaaggcgtacccc
gtcgtcaacgcgacggtcgacggcgacagcatcgtgtaccccgaccacgagaacatcagc
atcgcggtcgacacggagcgtggcctcctgacccccgtcgtgaagaacgccgagggcaag
aacctggcgcagttcgcgtcggagatcgccgacctggccgcccgcacgcgcgacaacaag
ctgtcaccggacgagctggccggcggcaccttcacgctgaccaacaccgggtcgcgcgga
gcgctcttcgacacccctgtggtgttcctgccgcagtccgcgatcctcggcacgggcatc
gtcaccaagcggcccgtggtcatcacggcggacgggcaggacacgatcgccatccgctcc
accgtctacctggcgctgtcctacgatcaccgcatcgtcgacggggctgacgcatcccgg
ttcctcgtcgccgtgaagaaccgactcgaagcgggtgcgttcgacgccgacctcggcatc
tag

DBGET integrated database retrieval system