KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_1641Help
Entry
CMM_1641          CDS       T00529                                 

Gene name
aceF
Definition
putative pyruvate/2-oxoglutarate dehydrogenase complex dihydrolipoamide acyltransferase (E2) component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cmi01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cmi00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cmi00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1855324..1856766)
Genome map
AA seq 480 aa AA seqDB search
MSESVNLPALGESVTEGTVTRWLKNVGDHVEVDEPLLEVSTDKVDTEIPSPVAGVIEEIL
VQEDETVEVGAVLVRIGDGSGGGDAPAEEPAAAAEPETATEEPAEDTVIPSTEGDDDAEA
PAPVEPEPAPAAEAETPAPATPPAPAPAAPAPVAAAPAPAPAAPTPAAAPAPAASGNAGY
VTPLVRKLANERGVDIGSVTGTGVGGRIRKEDVLAAAEAAASKSAPTASAPAAPAAAPLE
TSPLRGTTAKMSRMRKLIADRAVVSMQSTAQLTSVVEVDVTKVARFRDRVKGDFLEKTGV
KLSFLPFFALAAAEALKAYPVVNATVDGDSIVYPDHENISIAVDTERGLLTPVVKNAEGK
NLAQFASEIADLAARTRDNKLSPDELAGGTFTLTNTGSRGALFDTPVVFLPQSAILGTGI
VTKRPVVITADGQDTIAIRSTVYLALSYDHRIVDGADASRFLVAVKNRLEAGAFDADLGI
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatccgtcaacctccccgcactcggcgagagcgtcaccgagggcacggtgacc
cgttggctcaagaacgtcggcgaccacgtcgaggtcgacgagcccctgctcgaggtgtcg
accgacaaggtcgacaccgagatcccctcgccggtcgccggcgtgatcgaggagatcctc
gtccaggaggacgagaccgtcgaggtgggcgccgtgctggtgcgcatcggcgacggctcc
ggtggcggcgacgcgcccgcggaggagcccgccgccgcagcggagccggagacggcgacc
gaggagcccgccgaggacaccgtgatcccctccaccgagggggacgacgacgccgaggcg
cctgctcccgtcgagcccgagccggccccggccgctgaggcggagacgcccgctcccgcg
acgcccccggcacccgctcccgccgctcctgctcctgtcgccgctgctccggcgcccgct
cctgcagctccgacgcccgccgccgccccggctcctgctgcgtccggcaacgcgggctac
gtcaccccgctggtgcgcaagctcgccaacgagcggggggtcgacatcggctccgtgacc
ggcaccggtgtgggagggcgcatccgcaaggaggacgtgctcgccgctgccgaggccgcc
gcgtcgaagagcgccccgaccgcctcggctcccgcggcgcccgccgccgctccgctcgag
acgtcgccgctccgtggcacgaccgcgaagatgtcccgcatgcgcaagctcatcgccgac
cgcgctgtggtctcgatgcagtccaccgcgcagctcacctcggtggtcgaggtcgacgtc
acgaaggtggcccgcttccgcgaccgcgtgaagggcgacttcctcgagaagacgggcgtc
aagctctcgttcctgcccttcttcgcactcgccgccgctgaggcgctcaaggcgtacccc
gtcgtcaacgcgacggtcgacggcgacagcatcgtgtaccccgaccacgagaacatcagc
atcgcggtcgacacggagcgtggcctcctgacccccgtcgtgaagaacgccgagggcaag
aacctggcgcagttcgcgtcggagatcgccgacctggccgcccgcacgcgcgacaacaag
ctgtcaccggacgagctggccggcggcaccttcacgctgaccaacaccgggtcgcgcgga
gcgctcttcgacacccctgtggtgttcctgccgcagtccgcgatcctcggcacgggcatc
gtcaccaagcggcccgtggtcatcacggcggacgggcaggacacgatcgccatccgctcc
accgtctacctggcgctgtcctacgatcaccgcatcgtcgacggggctgacgcatcccgg
ttcctcgtcgccgtgaagaaccgactcgaagcgggtgcgttcgacgccgacctcggcatc
tag

DBGET integrated database retrieval system