KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_1641Help
Entry
CMM_1641          CDS       T00529                                 

Gene name
aceF
Definition
(GenBank) putative pyruvate/2-oxoglutarate dehydrogenase complex dihydrolipoamide acyltransferase (E2) component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
cmi00020  Citrate cycle (TCA cycle)
cmi00310  Lysine degradation
cmi01100  Metabolic pathways
cmi01110  Biosynthesis of secondary metabolites
cmi01120  Microbial metabolism in diverse environments
cmi01130  Biosynthesis of antibiotics
cmi01200  Carbon metabolism
Module
cmi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cmi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CMM_1641 (aceF)
  Amino acid metabolism
   00310 Lysine degradation
    CMM_1641 (aceF)
Enzymes [BR:cmi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CMM_1641 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: CAN01693
UniProt: A5CRI4
Position
complement(1855324..1856766)
Genome map
AA seq 480 aa AA seqDB search
MSESVNLPALGESVTEGTVTRWLKNVGDHVEVDEPLLEVSTDKVDTEIPSPVAGVIEEIL
VQEDETVEVGAVLVRIGDGSGGGDAPAEEPAAAAEPETATEEPAEDTVIPSTEGDDDAEA
PAPVEPEPAPAAEAETPAPATPPAPAPAAPAPVAAAPAPAPAAPTPAAAPAPAASGNAGY
VTPLVRKLANERGVDIGSVTGTGVGGRIRKEDVLAAAEAAASKSAPTASAPAAPAAAPLE
TSPLRGTTAKMSRMRKLIADRAVVSMQSTAQLTSVVEVDVTKVARFRDRVKGDFLEKTGV
KLSFLPFFALAAAEALKAYPVVNATVDGDSIVYPDHENISIAVDTERGLLTPVVKNAEGK
NLAQFASEIADLAARTRDNKLSPDELAGGTFTLTNTGSRGALFDTPVVFLPQSAILGTGI
VTKRPVVITADGQDTIAIRSTVYLALSYDHRIVDGADASRFLVAVKNRLEAGAFDADLGI
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatccgtcaacctccccgcactcggcgagagcgtcaccgagggcacggtgacc
cgttggctcaagaacgtcggcgaccacgtcgaggtcgacgagcccctgctcgaggtgtcg
accgacaaggtcgacaccgagatcccctcgccggtcgccggcgtgatcgaggagatcctc
gtccaggaggacgagaccgtcgaggtgggcgccgtgctggtgcgcatcggcgacggctcc
ggtggcggcgacgcgcccgcggaggagcccgccgccgcagcggagccggagacggcgacc
gaggagcccgccgaggacaccgtgatcccctccaccgagggggacgacgacgccgaggcg
cctgctcccgtcgagcccgagccggccccggccgctgaggcggagacgcccgctcccgcg
acgcccccggcacccgctcccgccgctcctgctcctgtcgccgctgctccggcgcccgct
cctgcagctccgacgcccgccgccgccccggctcctgctgcgtccggcaacgcgggctac
gtcaccccgctggtgcgcaagctcgccaacgagcggggggtcgacatcggctccgtgacc
ggcaccggtgtgggagggcgcatccgcaaggaggacgtgctcgccgctgccgaggccgcc
gcgtcgaagagcgccccgaccgcctcggctcccgcggcgcccgccgccgctccgctcgag
acgtcgccgctccgtggcacgaccgcgaagatgtcccgcatgcgcaagctcatcgccgac
cgcgctgtggtctcgatgcagtccaccgcgcagctcacctcggtggtcgaggtcgacgtc
acgaaggtggcccgcttccgcgaccgcgtgaagggcgacttcctcgagaagacgggcgtc
aagctctcgttcctgcccttcttcgcactcgccgccgctgaggcgctcaaggcgtacccc
gtcgtcaacgcgacggtcgacggcgacagcatcgtgtaccccgaccacgagaacatcagc
atcgcggtcgacacggagcgtggcctcctgacccccgtcgtgaagaacgccgagggcaag
aacctggcgcagttcgcgtcggagatcgccgacctggccgcccgcacgcgcgacaacaag
ctgtcaccggacgagctggccggcggcaccttcacgctgaccaacaccgggtcgcgcgga
gcgctcttcgacacccctgtggtgttcctgccgcagtccgcgatcctcggcacgggcatc
gtcaccaagcggcccgtggtcatcacggcggacgggcaggacacgatcgccatccgctcc
accgtctacctggcgctgtcctacgatcaccgcatcgtcgacggggctgacgcatcccgg
ttcctcgtcgccgtgaagaaccgactcgaagcgggtgcgttcgacgccgacctcggcatc
tag

DBGET integrated database retrieval system