KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_1673Help
Entry
CMM_1673          CDS       T00529                                 

Gene name
xysA
Definition
endo-1,4-beta-xylanase A (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Brite
Enzymes [BR:cmi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     CMM_1673 (xysA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1895220..1896515
Genome map
AA seq 431 aa AA seqDB search
MTLIPRRPRASVRTAPSLPDRDARRRPRRGLAALASAAAVLTAVAIGVPAGSASAAAPST
PVPGMQVPALKDVLGDAGIEHVGVAMGSGEVQGTSADLIARHFNAMTPENEGKADAIQPV
EGRFDFSGIDKLLDFADAHGMKMYFHVPYWKPQTPAWFFLDNGRPLTNSPADQALLKARM
EAHMKAIADHVASRYPKGNSPIWAMDVVNEVIDDGPNGNPHDMKDTPFFRVLGEGFVDEA
FQLAKKYFPGVKLFINEYNTDSPSKRADYLGLVSDLLERHIPVEGVSQQSHIGLRSDIEE
LRNTIHAVKALDPNLLQAISELDVGASQAAATGNSENRNHTAPIYSNPDDTAAAVGWVYK
DLFTMIRQEAANLESVTFWGSDNSRTWLHSPSIDQPWDQPLPFGTHQEATPAYWGIVRPD
LLPPRPPLPKG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcatcccacgccgtccccgcgcgtccgtccgcacggcgccgtccctcccggac
cgcgacgcccgccgtcgcccccgtcgcggcctcgccgccctcgcatcggccgccgccgtc
ctcaccgcggtcgccatcggcgtccccgcgggttcggcatccgccgccgcgcccagcacg
cccgtccccggcatgcaggtccccgctctcaaggacgtcctcggcgacgccggcatcgag
cacgtcggcgtggccatgggcagcggcgaggtgcagggcacctcggccgacctcatcgcc
cgtcacttcaacgccatgaccccggagaacgagggcaaggccgacgccatccagcccgtc
gagggccgattcgacttctcgggcatcgacaagctgctcgacttcgccgacgcccacggc
atgaagatgtacttccacgtcccgtactggaagccgcagacgcccgcgtggttcttcctc
gacaacggccgaccgctgacgaacagcccggccgaccaggcgctgctcaaggcgcgcatg
gaagcccacatgaaggcgatcgccgaccacgtcgcgtcccgctacccgaaggggaacagc
cccatctgggccatggacgtcgtcaacgaggtcatcgacgacggccccaacggcaacccg
cacgacatgaaggacacgcccttcttccgggtgctcggcgagggcttcgtcgacgaggcc
ttccagctcgcgaagaagtacttcccgggcgtcaagctcttcatcaacgagtacaacacc
gactcgccgagcaagcgcgccgactacctcgggctcgtctccgacctcctggagcggcac
atcccggtcgagggcgtgtcgcagcagagccacatcgggctccgcagcgacatcgaagag
ctgaggaacacgatccacgcggtgaaggccctcgacccgaacctcctccaggccatctcc
gagctggacgtcggtgcgtcgcaggccgccgcgacgggcaacagcgagaaccggaaccac
acggcgccgatctactcgaacccggacgacaccgccgcggccgtgggctgggtctacaag
gacctgttcacgatgatccggcaggaggccgcgaacctcgagtcggtcaccttctggggc
tccgacaactcgcgcacctggctgcacagcccgtcgatcgaccagccgtgggaccagccg
ctcccgttcgggacccatcaggaggccacgcccgcgtactggggcatcgtgaggcccgac
ctgctcccgccgcgtccgccgctgccgaagggctga

DBGET integrated database retrieval system