KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_1674Help
Entry
CMM_1674          CDS       T00529                                 

Gene name
xysB
Definition
endo-1,4-beta-xylanase A (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1896686..1898695
Genome map
AA seq 669 aa AA seqDB search
MSIPRTSASASADVSPPRLDRSRSAGSRAVGARPARRRGMAAITALGLVVGAGALAAPSA
QAADAAAPARIGSDFESGTDGWAPRGDGVAIAPSTIARTGSGSLLVTDRTQEWHGAALDV
TSALAVGQQVEVTVWARLAAGEEPASLKVSVQRDTGGGSGYDGVAGAAARVTADAWTELT
GTYTLGGPVDRAQVYVEGTVGADFLLDDFQLGEAVATPVQTDIPALKDVLGARGIEHVGV
AIDGRETVGAGADLVSRQFDAFTPENAGKPESVQPEEGRFTFTQLDQLLDFADRTGTEVY
YHVLFWHSQTPAWFFLDGDRPLTDSPADQALLKARMEAHVTGIADHIAARYPDGNSPIWA
MDVVNEVIDDGPNDNAHDMRDSRWYQVLGEGFVDEGFRLARAHFPGVKLFINDYNTELPT
KRADYLELISALVARGVPIDGVGHQAHVDFARPVSWLRDSIRAVERIDPRLLQAITELDV
NASNQNEGADVSGAPQDPYTPVYADDAQAGAEVGYYYRDLFQMIRQQAASIDSVTFWGVS
NARSWLRTWPIARPWEQPLPFDDDLQAAPAYWGIVDPRQLPARPADLSAPRIADVDDITA
VATRAAGVRVPYALPSAIDTRDGNVRVVCAPPRSGIFPVGTTTVTCTAKDRAGNVRTSTF
DVIVTRAGS
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgagcattccccgcaccagcgcgtccgcgtccgcggacgtcagcccgccccgcctggac
cgcagcaggtccgccggcagccgcgccgtcggcgcccgtcccgcccgccgccggggcatg
gcggcgatcacggcgctcggcctcgtcgtgggcgcaggcgccctcgccgcgccgtccgca
caggccgccgacgccgccgctcccgcacgcatcggatccgacttcgagtccggcacggac
ggctgggccccgcgcggcgacggcgtcgcgatcgcgcccagcacgatcgcgcgcaccgga
tccggcagcctgctcgtgaccgaccgtacgcaggagtggcacggggcagccctcgacgtg
acgagcgccctcgccgtgggccagcaggtcgaggtgacggtgtgggcgcgcctggccgcg
ggggaggagcccgcgtccctcaaggtctccgtgcagcgcgacaccggcggcggcagcgga
tacgacggggtggcgggagccgcggcgcgggtcaccgccgacgcgtggaccgagctcacc
ggcacgtacacgctcggcggcccggtcgacagggcgcaggtctacgtcgagggcaccgtc
ggcgccgacttcctcctcgacgacttccagctgggcgaggccgtggccacgcccgtgcag
accgacatcccggcgctcaaggacgtcctcggcgcccgcggcatcgagcacgtgggcgtc
gccatcgacggtcgcgagaccgtgggcgcgggagcggatctggtgagccgccagttcgac
gcgttcacgccggagaacgccggcaagcccgagagcgtccagccggaggaggggcgcttc
accttcacgcagctcgaccagctgctcgacttcgccgaccgcaccggcacggaggtgtac
taccacgtgctgttctggcactcgcagacgcccgcgtggttcttcctcgacggcgaccgc
ccccttaccgacagccccgcggatcaggcgctgctgaaggcgcgcatggaggcgcacgtg
acggggatcgccgaccacatcgccgcgcgctaccccgacgggaacagcccgatctgggcg
atggacgtcgtcaacgaggtcatcgacgacggtcccaacgacaacgcgcacgacatgcgc
gacagccgctggtaccaggtgctgggggaggggttcgtcgacgagggcttccgcctcgcc
cgcgcgcacttcccgggcgtcaagctgttcatcaacgactacaacacggagctgcccacc
aagcgcgccgactacctcgagctgatctccgcgctcgtcgcccgcggcgtgccgatcgac
ggggtgggccaccaggcgcacgtcgacttcgcccggccggtctcgtggctgcgcgactcg
atccgcgcggtcgagcgcatcgacccgcgcctgctgcaggcgatcaccgagctcgacgtg
aacgcgtcgaaccagaacgagggcgccgacgtgagcggcgcgccgcaggatccgtacacg
ccggtctacgcggacgatgcgcaggcgggagccgaggtcggctattactaccgcgacctc
ttccagatgatccgccagcaggcggcatccatcgactcggtcaccttctggggagtgagc
aacgcgcgcagctggctgcgcacgtggccgatcgcgcgtccgtgggagcagccgctgccg
ttcgacgacgacctgcaggcggctcccgcctactggggcatcgtggatccgaggcagctc
ccggcgcgtcccgcggacctctcggcgccgcgcatcgcggacgtggatgacatcacggcg
gtcgcgacgagggccgcgggcgtgcgcgtgccgtacgcgctgccttcggccatcgacacc
cgggacgggaacgtgcgggtcgtctgcgcgccgccccgcagcgggatcttccccgtcggc
accacgacggtcacctgcaccgcgaaggaccgcgccggcaacgtccggacgagcaccttc
gacgtgatcgtgacgcgcgccggctcgtga

DBGET integrated database retrieval system