KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_1742Help
Entry
CMM_1742          CDS       T00529                                 

Gene name
tpiA
Definition
(GenBank) putative triosephosphate isomerase (YP_062107.1| triosephosphate isomerase [Leifsonia xyli subsp. xyli str. CTCB07]; Q829W1|TPIS_STRAW Triosephosphate isomerase (TIM)). pfam00121, TIM, Triosephosphate isomerase.; High confidence in function and specificity
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
cmi00010  Glycolysis / Gluconeogenesis
cmi00051  Fructose and mannose metabolism
cmi00562  Inositol phosphate metabolism
cmi01100  Metabolic pathways
cmi01110  Biosynthesis of secondary metabolites
cmi01120  Microbial metabolism in diverse environments
cmi01130  Biosynthesis of antibiotics
cmi01200  Carbon metabolism
cmi01230  Biosynthesis of amino acids
Module
cmi_M00002  Glycolysis, core module involving three-carbon compounds
cmi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CMM_1742 (tpiA)
   00051 Fructose and mannose metabolism
    CMM_1742 (tpiA)
   00562 Inositol phosphate metabolism
    CMM_1742 (tpiA)
Enzymes [BR:cmi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CMM_1742 (tpiA)
Exosome [BR:cmi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CMM_1742 (tpiA)
  Exosomal proteins of bladder cancer cells
   CMM_1742 (tpiA)
  Exosomal proteins of melanoma cells
   CMM_1742 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAN01798
UniProt: A5CRT5
Position
complement(1968777..1969574)
Genome map
AA seq 265 aa AA seqDB search
MTDRPQGRTPLIAGNWKMNLDHLQAIAFVQKLAWSLKDAKHDYAEAEVAVFPPATDIRSV
QTLVSADKLELAYGAQDVSEHESGAYTGEISAAFLAQLACRYVIVGHSERRTLHGETDEQ
VAAKSAAAVKHGIVPVICVGETAADLEEHGASAVPVAQLRVALQGLPKGADVVVAYEPVW
AIGSGQAATPEQAQQVASPIRAVVAELLGDEAAKATRILYGGSVKSGNIAGFLREPDVDG
ALVGGASLDVQEFSAIARFRSHVGV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgatcgcccgcaggggcgcacgcccctcatcgcgggcaactggaagatgaacctg
gaccacctccaggccatcgcgttcgtccagaagctcgcgtggagcctcaaggacgccaag
cacgactacgcggaggcggaggtcgcggtcttcccgccggccaccgacatccgcagcgtg
cagacgctcgtctcggccgacaagctcgagctggcctacggcgcccaggacgtctccgag
cacgagtcgggcgcgtacacgggggagatctccgcggcgttcctggcgcagctcgcctgc
cggtacgtcatcgtcggccactccgagcggcgcacgctgcacggcgagaccgacgagcag
gtggccgccaagtcagctgccgcggtgaagcacggcatcgtcccggtgatctgcgtgggc
gagacggccgctgacctcgaggagcacggcgccagcgccgtccccgtggcccagctgcgc
gtcgcgctccagggcctgccgaagggcgccgacgtggtcgtcgcctacgagcccgtgtgg
gccatcgggtccggccaggccgcgacgccggagcaggcccagcaggtcgcctccccgatc
cgcgcggtcgtcgccgagctcctgggcgacgaggccgcgaaggccacgcgcatcctctac
ggcggctcggtcaagtccggcaacatcgcgggcttcctccgcgagcccgacgtggacggc
gcgctcgtcggcggcgccagcctcgacgtgcaggagttctccgccatcgcgcggttccgc
tcccacgtcggcgtctga

DBGET integrated database retrieval system