KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_1742Help
Entry
CMM_1742          CDS       T00529                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CMM_1742 (tpiA)
   01230 Biosynthesis of amino acids
    CMM_1742 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CMM_1742 (tpiA)
   00051 Fructose and mannose metabolism
    CMM_1742 (tpiA)
   00562 Inositol phosphate metabolism
    CMM_1742 (tpiA)
Enzymes [BR:cmi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CMM_1742 (tpiA)
Exosome [BR:cmi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CMM_1742 (tpiA)
  Exosomal proteins of bladder cancer cells
   CMM_1742 (tpiA)
  Exosomal proteins of melanoma cells
   CMM_1742 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1968777..1969574)
Genome map
AA seq 265 aa AA seqDB search
MTDRPQGRTPLIAGNWKMNLDHLQAIAFVQKLAWSLKDAKHDYAEAEVAVFPPATDIRSV
QTLVSADKLELAYGAQDVSEHESGAYTGEISAAFLAQLACRYVIVGHSERRTLHGETDEQ
VAAKSAAAVKHGIVPVICVGETAADLEEHGASAVPVAQLRVALQGLPKGADVVVAYEPVW
AIGSGQAATPEQAQQVASPIRAVVAELLGDEAAKATRILYGGSVKSGNIAGFLREPDVDG
ALVGGASLDVQEFSAIARFRSHVGV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgatcgcccgcaggggcgcacgcccctcatcgcgggcaactggaagatgaacctg
gaccacctccaggccatcgcgttcgtccagaagctcgcgtggagcctcaaggacgccaag
cacgactacgcggaggcggaggtcgcggtcttcccgccggccaccgacatccgcagcgtg
cagacgctcgtctcggccgacaagctcgagctggcctacggcgcccaggacgtctccgag
cacgagtcgggcgcgtacacgggggagatctccgcggcgttcctggcgcagctcgcctgc
cggtacgtcatcgtcggccactccgagcggcgcacgctgcacggcgagaccgacgagcag
gtggccgccaagtcagctgccgcggtgaagcacggcatcgtcccggtgatctgcgtgggc
gagacggccgctgacctcgaggagcacggcgccagcgccgtccccgtggcccagctgcgc
gtcgcgctccagggcctgccgaagggcgccgacgtggtcgtcgcctacgagcccgtgtgg
gccatcgggtccggccaggccgcgacgccggagcaggcccagcaggtcgcctccccgatc
cgcgcggtcgtcgccgagctcctgggcgacgaggccgcgaaggccacgcgcatcctctac
ggcggctcggtcaagtccggcaacatcgcgggcttcctccgcgagcccgacgtggacggc
gcgctcgtcggcggcgccagcctcgacgtgcaggagttctccgccatcgcgcggttccgc
tcccacgtcggcgtctga

DBGET integrated database retrieval system