KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_1762Help
Entry
CMM_1762          CDS       T00529                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (YP_062084.1| tryptophan synthase alpha subunit [Leifsonia xyli subsp. xyli str. CTCB07]; O68906|TRPA_MYCIT Tryptophan synthase alpha chain). The alpha subunit is responsible for the aldol cleavage of indoleglycerol phosphate to indole and glyceraldehyde 3-phosphate. pfam00290, Trp_syntA,Tryptophan synthase alpha chain. trpA: tryptophan synthase alpha subun; High confidence in function and specificity
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
cmi00260  Glycine, serine and threonine metabolism
cmi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cmi01100  Metabolic pathways
cmi01110  Biosynthesis of secondary metabolites
cmi01130  Biosynthesis of antibiotics
cmi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CMM_1762 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CMM_1762 (trpA)
Enzymes [BR:cmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CMM_1762 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: CAN01818
UniProt: A5CRV5
Position
complement(1999049..1999861)
Genome map
AA seq 270 aa AA seqDB search
MTAHAAPPAVSPVERAIAVRREQGSGALVGYLPVGFPDLATSIEAAVALVENGVDVIELG
LPYSDPVMDGPVIQRATQTALAQGFRLRDGFDALHAITQRVDAPVLLMTYWNPVVQYGVE
RFADDIVAAGGAGLITPDLIPDEGADWLAASERTGLDRVFLAAPSSSEARLRQGVERSRG
FVYAVSTMGITGARQDVDQAARGLVSRLRDAGSTSACVGIGISTGDQVREVLDYADGAIV
GSALVAALADGGVPGVARAAADLARGTALQ
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgctcacgccgcaccgcccgccgtcagtcccgtcgagcgggccatagcggtccgc
cgcgagcagggatcgggcgccctcgtcgggtacctccccgtcggcttccccgacctcgcc
acgagcatcgaggccgccgtcgcgctcgtcgagaacggcgtcgacgtcatcgagctcggc
ctgccgtacagcgaccccgtgatggacggcccggtcatccagcgcgcgacccagacggcg
ctcgcgcagggcttccgcctccgcgacggcttcgacgcgctgcacgcgatcacccagcgc
gtcgacgcgcccgtgctcctcatgacctactggaaccccgtcgtgcagtacggcgtcgag
cgcttcgcggacgacatcgtcgccgcgggcggcgccggcctcatcacgcccgacctcatc
ccggacgagggcgccgactggctggccgcgtccgagcgcacgggcctcgaccgcgtgttc
ctcgcggccccgtcgtccagcgaggcgcgcctgcgccagggggtcgagcgcagccgcggg
ttcgtctacgcggtctcgaccatgggcataacgggcgcgcgccaggacgtcgaccaggcc
gcccgcggactcgtctcgcgcctgcgcgacgccggctccacgagcgcgtgcgtcggcatc
ggcatctccaccggcgaccaggtgcgcgaggtgctcgactacgccgacggcgccatcgtc
ggatccgccctcgtcgcggccctcgccgacggcggcgtgcccggcgtcgcccgcgccgcg
gccgatctcgcgcggggaaccgcgctacagtag

DBGET integrated database retrieval system