KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_1762Help
Entry
CMM_1762          CDS       T00529                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CMM_1762 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CMM_1762 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CMM_1762 (trpA)
Enzymes [BR:cmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CMM_1762 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1999049..1999861)
Genome map
AA seq 270 aa AA seqDB search
MTAHAAPPAVSPVERAIAVRREQGSGALVGYLPVGFPDLATSIEAAVALVENGVDVIELG
LPYSDPVMDGPVIQRATQTALAQGFRLRDGFDALHAITQRVDAPVLLMTYWNPVVQYGVE
RFADDIVAAGGAGLITPDLIPDEGADWLAASERTGLDRVFLAAPSSSEARLRQGVERSRG
FVYAVSTMGITGARQDVDQAARGLVSRLRDAGSTSACVGIGISTGDQVREVLDYADGAIV
GSALVAALADGGVPGVARAAADLARGTALQ
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgctcacgccgcaccgcccgccgtcagtcccgtcgagcgggccatagcggtccgc
cgcgagcagggatcgggcgccctcgtcgggtacctccccgtcggcttccccgacctcgcc
acgagcatcgaggccgccgtcgcgctcgtcgagaacggcgtcgacgtcatcgagctcggc
ctgccgtacagcgaccccgtgatggacggcccggtcatccagcgcgcgacccagacggcg
ctcgcgcagggcttccgcctccgcgacggcttcgacgcgctgcacgcgatcacccagcgc
gtcgacgcgcccgtgctcctcatgacctactggaaccccgtcgtgcagtacggcgtcgag
cgcttcgcggacgacatcgtcgccgcgggcggcgccggcctcatcacgcccgacctcatc
ccggacgagggcgccgactggctggccgcgtccgagcgcacgggcctcgaccgcgtgttc
ctcgcggccccgtcgtccagcgaggcgcgcctgcgccagggggtcgagcgcagccgcggg
ttcgtctacgcggtctcgaccatgggcataacgggcgcgcgccaggacgtcgaccaggcc
gcccgcggactcgtctcgcgcctgcgcgacgccggctccacgagcgcgtgcgtcggcatc
ggcatctccaccggcgaccaggtgcgcgaggtgctcgactacgccgacggcgccatcgtc
ggatccgccctcgtcgcggccctcgccgacggcggcgtgcccggcgtcgcccgcgccgcg
gccgatctcgcgcggggaaccgcgctacagtag

DBGET integrated database retrieval system