KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_1764Help
Entry
CMM_1764          CDS       T00529                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase (YP_062082.1| indole-3-glycerol phosphate synthase [Leifsonia xyli subsp. xyli str. CTCB07]; ZP_00206714.1| COG0134: Indole-3-glycerol phosphate synthase [Bifidobacterium longum DJO10A]). pfam00218, IGPS, Indole-3-glycerol phosphate synthase.; High confidence in function and specificity (EC:4.1.1.48)
  KO
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CMM_1764 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CMM_1764 (trpC)
Enzymes [BR:cmi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CMM_1764 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2001069..2001845)
Genome map
AA seq 258 aa AA seqDB search
MLGDLLAGALEDAAARRETRPLAQVEAEALACPAALDALGALAPADRVKIIAEVKRSSPS
RGALAEIPDPALLASRYETGGASAISVLTEGRKFRGSLQDLEQVRDTVSIPVLRKDFIGE
PYQVLEARASGADLVLLIVAALDQKTLVELHALVGELGMTALVETHSAEEVSRALDLGAQ
VVGVNARNLTTFELDRDLFGRLADSIPAGVVRIAESAVKTADDVAHYRRSGADVVLVGEA
LVTGDPVRTLSEFLDIRA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgctgggcgacctcctcgccggcgccctcgaggacgcggccgcccgccgcgagacccgt
ccgctcgcccaggtcgaggccgaggcgctcgcgtgtcccgccgccctcgacgcgctcggc
gccctcgcgcccgccgaccgcgtgaagatcatcgccgaggtcaagcgctcgagcccctcg
cgcggcgccctcgccgagatcccggatcccgcgctcctcgcgtcccgttacgagaccggc
ggcgccagcgccatcagcgtcctcaccgagggccgcaagttccgcggatccctccaggac
ctcgagcaggtgcgcgacaccgtctccatcccggtgctccgtaaggacttcatcggcgag
ccgtaccaggtgctcgaggcccgcgcgtccggcgccgacctcgtcctcctcatcgtcgcc
gcgctcgaccagaagacgctcgtcgagctgcacgcgctggtgggcgagctcggcatgacc
gcgctcgtcgagacccactccgcggaggaggtgtcccgcgcgctcgacctcggcgcgcag
gtcgtcggcgtcaacgcgcgcaacctgaccacgttcgagctcgaccgcgacctgttcggc
cgcctggccgactccatccccgcgggcgtcgtccgcatcgccgagtccgcggtgaagacc
gcggacgacgtggcgcactaccgccgctcgggcgccgacgtcgtgctggtgggcgaggcg
ctcgtcacgggcgatcccgtccgcacgctctccgagttcctggacatccgggcatga

DBGET integrated database retrieval system