KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_1780Help
Entry
CMM_1780          CDS       T00529                                 

Gene name
gmkA
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CMM_1780 (gmkA)
Enzymes [BR:cmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CMM_1780 (gmkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2015417..2016325)
Genome map
AA seq 302 aa AA seqDB search
MRPEPPEVDRVAASQAAVAARRARAQVKHDIVTGERTPLGVLDASADPAHRAEATLRVTE
FLTSIPNIGPTKLERILGDLGISTAKRLGGLGVHQRVRLTRFLEEWQAAKQIVEPSWLVV
LAGPTAVGKGTVSTFIRENEPDVLLSVSATTRAPRPGEVEGVNYYFVSDAEFDRMVDERE
LLEWATVHNAHRYGTPRAPIDAALAEGRSVLLEIDIQGARQVKAAMPEARLVFLLPPTWE
ELVRRLVGRGTEGPEEQQRRLDTAKVELAAQDEFDHLVVNRDVAEAAREVVDLMRSRKAV
GP
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaggcccgaaccacccgaggtcgaccgggtcgccgcgtcgcaggccgccgtcgcggcc
cgccgcgcacgcgcgcaggtgaagcacgacatcgtcacgggggagcgcacgccgctcggc
gtcctcgacgcgtcggcggaccccgcccaccgcgccgaggccacgctccgggtcaccgag
ttcctcacgagcatcccgaacatcggccccaccaagctcgagcggatcctcggcgacctc
ggcatctccaccgccaagcgcctcggcggcctgggcgtgcaccagcgcgtgcgcctcacc
cggttcctcgaggagtggcaggccgcgaagcagatcgtcgagcccagctggctcgtcgtc
ctcgcgggtcccaccgcggtgggcaagggcacggtctccaccttcatccgcgagaacgag
cccgacgtgctgctctccgtctccgccaccacgcgcgccccgcgtcccggcgaggtcgag
ggcgtcaactactacttcgtctccgacgccgagttcgaccgcatggtcgacgagcgcgag
ctcctcgagtgggccacggtgcacaacgcgcaccgctacggcacgccgcgcgcgcccatc
gacgccgcgctggccgagggccggagcgtgctgctggagatcgacatccagggcgcgcgc
caggtgaaggccgcgatgcccgaggcgcggctcgtgttcctgctgccgcccacctgggag
gagctcgtgcgccgcctggtcggtcgcggcaccgaagggcccgaggagcagcagcgccgg
ctcgacaccgcgaaggtcgagctggccgcccaggacgagttcgaccatctcgtcgtcaac
cgcgatgtcgcggaggcggcgcgcgaggtcgtagacttgatgagatccaggaaggccgtc
ggtccatga

DBGET integrated database retrieval system