KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_1815Help
Entry
CMM_1815          CDS       T00529                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cmi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2053613..2054257)
Genome map
AA seq 214 aa AA seqDB search
MISSLRGTVLSVSGQTLLLEVHGVGYGVSVTPRHALELRNGSEATVLTSLVVREDSLTLF
GFPGPDELRAFELLCGVTGVGPKSALAVLEHLDPEAMAQAVAAEDDAAFRRVSGIGPKTA
KLIVLQLAGKLFVTQPRARSATSAASTVTADVVTALIGLGWSERVARTAVDDAAAAAADQ
GLPADMPRLLRVALGMLGPQQPAGAAPTGQAADR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgatctcctccctccgtggcaccgtgctgtccgtctccggtcagaccctcctgctggag
gtgcacggggtgggctacggcgtctcggtgacgccgcggcacgcgctcgagctgcggaac
ggatccgaggccaccgtgctcacgtcgctggtcgtccgcgaggactcgctcacgctcttc
ggcttccccgggccggacgagctgcgggcattcgagctgctctgcggcgtcactggcgtc
ggcccgaagtcggccctcgcggtgctcgagcacctggatccggaggccatggcccaggcc
gtcgccgcggaggacgacgccgccttccgccgcgtgtcgggcatcggaccgaagaccgcc
aagctcatcgtgctgcagctcgcggggaagctgttcgtcacccagccacgagcgcgttcg
gcgacgtccgccgcgtccaccgtcacggccgacgtcgtcacggccctcatcggcctcggc
tggtccgagcgcgtggctcgcaccgcggtcgacgacgccgcggccgcggcggccgatcag
gggctgcccgccgacatgccccgcctgctgcgcgtcgcgctcggcatgctcgggccgcag
cagcccgcgggcgcggccccgaccggtcaggcggccgaccgatga

DBGET integrated database retrieval system