KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_1824Help
Entry
CMM_1824          CDS       T00529                                 

Definition
putative peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:cmi00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cmi00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2063716..2064207
Genome map
AA seq 163 aa AA seqDB search
MTHPRLDPIPLTTLQGEATTFGAYADKVVLVVNVASRCGLAPQYEKLEQLQRTYGERGFT
VIGFPSNQFLQELGSAEAIDEYCSTTWGVTFPMMEKVKVNGRSAHPVYAELTKTPDADGK
AGRVKWNFEKFVVTPTGAVHRFRPTVEPDAPEIVSLIESELPA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgacgcatccccggctcgacccgatcccgctgaccaccctccagggcgaggccaccacc
ttcggcgcgtacgccgacaaggtcgtgctcgtcgtcaacgtcgcctcgcgctgcggcctc
gcgccgcagtacgagaagctggagcagctgcagcgcacctacggcgagcggggcttcacc
gtcatcggcttcccgagcaaccagttcctccaggagctcggatccgcggaggccatcgac
gagtactgctccaccacgtggggcgtcaccttcccgatgatggagaaggtcaaggtcaac
ggccggtccgcccaccccgtctacgcggagctgacgaagacgcccgacgcggacgggaag
gccggccgcgtgaagtggaacttcgagaagttcgtcgtcacgccgacgggagccgtgcac
cgcttccgccccacggtcgagccggacgcgccggagatcgtgtcgctcatcgagtccgag
ctgcccgcctga

DBGET integrated database retrieval system