KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_1831Help
Entry
CMM_1831          CDS       T00529                                 

Gene name
glpK
Definition
putative glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CMM_1831 (glpK)
Enzymes [BR:cmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CMM_1831 (glpK)
Exosome [BR:cmi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CMM_1831 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2068763..2070280
Genome map
AA seq 505 aa AA seqDB search
MSEKYIVAIDQGTTSTRAIVFDHSGSIVSTGQLEHEQIFPRAGWVEHDPMEIWRNTREVI
GQALSKADITRHDVEAVGITNQRETAVVWDRTTGKPVYNAIVWQDTRTQKIVDRLAADGG
VERFKPTVGLPLATYFSGTKIVWILENVDGAREKAEAGELMFGTTDTWVLWNLTGGTDGG
VHVTDVTNASRTLFMDLETLQWDDEILKAFDVPRSMLPEIKSSSEVYGQVESSSLLREVP
IAGILGDQQAATFGQAAFDQGESKNTYGTGNFLIFNTGTDIIHSQNGLLTTLGYKLGDQE
PHYALEGSIAVTGSLVQWMRDNLGLVSSAAEIETLAATVEDNGGVYFVPAFSGLFAPYWR
SDARGALVGLTRYVNKGHIARAALEATAFQTREVLDAVNADSGVDLTELKVDGGMIANNL
LMQFQADILGVPVVRPVVAETTALGAAYAAGLAVGFWKDLDDLRQNWQEDSRWTPDMDDA
ERERQLRLWKKAVTKTFDWVDDDVQ
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaagtacatcgtcgccatcgaccagggcaccacgagcacgcgtgccatcgtc
ttcgaccacagcggatccatcgtgtccaccggccagctcgagcacgagcagatcttcccc
cgcgccggctgggtcgagcacgacccgatggagatctggcgcaacacgcgcgaggtcatc
ggccaggcgctgtccaaggccgacatcacgcgccacgacgtcgaggccgtcggcatcacc
aaccagcgcgagaccgccgtcgtatgggaccgcaccacgggcaagcccgtctacaacgcc
atcgtctggcaggacacccgcacgcagaagatcgtcgaccgcctggcggccgacggcggc
gtggagcgcttcaagcccaccgtcgggctcccgctcgccacctacttctcgggcacgaag
atcgtctggatcctcgagaacgtcgacggcgcccgcgagaaggccgaggccggcgagctc
atgttcggcacgaccgacacctgggtcctctggaacctcaccggcggcaccgacggcggc
gtgcacgtcaccgacgtcaccaacgcgtcgcgcacgctcttcatggacctcgagacgctc
cagtgggacgacgagatcctgaaggccttcgacgtgccgcgctcgatgctccccgagatc
aagagctcctccgaggtctacggccaggtcgagtcctcgagcctcctgcgcgaggtgccg
atcgccggcatcctgggcgaccagcaggccgccacgttcggccaggccgcattcgaccag
ggcgagtcgaagaacacctacggcaccggcaacttcctgatcttcaacaccggcaccgac
atcatccactcgcagaacggcctcctcaccacgctcggctacaagctgggcgaccaggag
ccgcactacgcgctcgagggctccatcgccgtcaccggctcgctcgtgcagtggatgcgc
gacaacctcggcctcgtgtcgagcgccgcggagatcgagacgctggccgccaccgtcgag
gacaacggcggcgtgtacttcgtccccgcgttctcgggcctgttcgcgccgtactggcgc
tcggacgcccggggcgcgctcgtgggcctcacgcgctacgtcaacaagggccacatcgcc
cgcgcggcgctggaggcgacggccttccagacgcgtgaggtgctcgacgcggtcaacgcc
gactcgggcgtcgacctcacggagctcaaggtcgacggcggcatgatcgccaacaacctg
ctgatgcagttccaggccgacatcctcggcgtgcccgtcgtccgccccgtcgtcgcggag
accactgcgctcggtgccgcgtacgccgcgggcctcgccgtcggattctggaaggacctc
gacgacctccgccagaactggcaggaggacagccggtggacgccggacatggacgacgcc
gagcgcgagcgccagctgcgcctctggaagaaggccgtcacgaagaccttcgactgggtc
gacgacgacgtgcagtag

DBGET integrated database retrieval system