KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_1876Help
Entry
CMM_1876          CDS       T00529                                 

Gene name
glkA
Definition
putative glucokinase catabolite repressor (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CMM_1876 (glkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CMM_1876 (glkA)
   00052 Galactose metabolism
    CMM_1876 (glkA)
   00500 Starch and sucrose metabolism
    CMM_1876 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    CMM_1876 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CMM_1876 (glkA)
   00524 Butirosin and neomycin biosynthesis
    CMM_1876 (glkA)
Enzymes [BR:cmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CMM_1876 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2120291..2121256)
Genome map
AA seq 321 aa AA seqDB search
MHAIGIDIGGTKIAGAVVDELGVIAVEERTPTEASSPDAIVEAVVGMVERLRALHPDVVA
VGVAAAGFIDAAQSTVYYAPNINWRNEPVREKLRGRIDLPIVIENDANAAGWAEFRYGAG
RLVSDMVTLTIGTGVGGAIVADDRLFRGGFGAGAELGHMRVVPDGLPCGCGARGCIEQYG
SGRALLRTADELADLGGTHGEGLAARRREVGTLTGHDVSDLIQAGDPGALLALRRLGGWL
GEAAASIGAILDPQMFVIGGGVAQAGDLLLGPIREAYLAHLPARGYHPEPEFRIAELVND
AGVVGAADLARRHAAALHHGA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgcatgcaatagggatcgacatcggcgggaccaagatcgcgggggcggtggtcgacgag
ctcggcgtcatcgcggtggaggagcgcacgcccaccgaggcgagcagcccggacgcgatc
gtggaggccgtcgtcggcatggtcgagcggctccgcgccctgcaccccgacgtcgtcgcg
gtcggcgtcgcggcggctggcttcatcgacgccgcgcagtccaccgtctactacgccccg
aacatcaactggcgcaacgagccggtgcgcgagaagctgcgcggccggatcgacctcccc
atcgtcatcgagaacgacgcgaacgccgccggctgggcggagttccgctacggcgcgggc
cgcctcgtcagcgacatggtcaccctcacgatcggcacgggcgtcggcggcgcgatcgtc
gccgacgaccggctcttccgtggcggcttcggcgcgggcgccgagctcggccacatgcgc
gtcgtccccgacggcctgccctgcggctgcggcgcccgcggctgcatcgagcagtacgga
tccggccgcgcgctcctgcgcaccgccgacgagctggccgacctcggcggcacgcacggg
gagggcctcgccgcccgccgccgcgaggtgggcacgctcaccgggcacgacgtcagcgac
ctcatccaggccggcgaccccggcgccctcctcgccctccgccgcctcggcggctggctc
ggcgaggccgccgcgagcatcggcgcgatcctcgatccccagatgttcgtgatcggcggc
ggcgtcgcgcaggcgggcgacctgctgctcggccccatccgcgaggcctacctcgcgcac
ctcccggcccgcgggtaccacccggagccggagttccgcatcgccgagctcgtcaacgac
gccggcgtcgtcggcgcggcggacctcgcccgtcgccacgcggccgcgctgcaccacggg
gcctga

DBGET integrated database retrieval system