KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_2109Help
Entry
CMM_2109          CDS       T00529                                 

Gene name
lacZ
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cmi00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cmi00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cmi00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2379114..2382167
Genome map
AA seq 1017 aa AA seqDB search
MTHALPYFEDFAPTTGAARRPRSCLHSDAPRIVLNGDWRFRLSPTPRGLSDEMADPAFDD
SGWDEIPVPSHWVLGQDGRFGLPAYTNVQYPFPVEPPFVPDENPTGDYRVEVDVPTDWQS
LERVVLRFEGVESAFKVWLNGEEVGTAMGSRLSHEFDVTASLRPGSNVLAVRVHQWSIAS
YLEDQDQWWMPGIFRDVTLLGRPEGGIDDAWTRAEYDHETGAGTVHVEVDAEPTAFPVTF
EVDGLGIHVTWDTPADVAPVHVDRVEPWSAESPTQYQGFLRTNVEALSIRLGFRTVRIEG
DRFLVNGRRVVFHGVNRHEAHPERGRVFDEEHARADMLLMKQHNVNAIRTSHYPPHPRVL
DLADELGFWVIDECDLETHGFEFGGWVGNPSDDPRFADHYLDRIERTIERDKNHPSIVMW
SLGNESGTGRNLAAMSAWVHRRDPGRPVHYEGDYTGEYTDVYSRMYSNLQETESIGSDVI
PGDLLGCTPGEGMRQRTKPFILCEYVHAMGNGPGQIGEYEDLVLRYPRLHGGFVWEWRDH
GILTETADGEAFYAYGGDFGEVVHDGNFVMDGMVLPDDTPTPGLAEYKAVVQPIAFGLER
DGGSASLVVENRYHSVSTALTSLVWVLAVDGDDVATGVLDAEAVPAGDTARIPLPADALD
AGELAGDGSEVWLTVQAILRDDEPWAEAGHVVAVQQFDLTPAPRPAVPARWVDADEETYP
ASGATRLTLGDGEFDLATGRLVRLGSLEVDGPRLELWRAPTDNDRSDSSGSYELADPRLT
FGKGVPGPSSEARWRGAGLDRLTHRVRSVKVGSGSLTVVVRTSAAQSFDSVDTTYCWTEG
ADGDLDLRVDIVPSAGWAITWPRVGIRFDLPASVTNAEWFGTGPFESYPDSRRAALVGRF
SSLVDDLGAVYSMPQETGHRSDLRELELGTFDGEDGIVIQARPDTAGRRPGFTASRHTPQ
ELDRAAHPHELPASEAVHLYIDAAQHGLGSRACGLDVLPEHQLWPSARTLELTIRSR
NT seq 3054 nt NT seq  +upstreamnt  +downstreamnt
atgacgcacgccctcccctacttcgaggacttcgcccccacgacgggcgccgcccgccgc
ccccgttcctgcctgcactcggatgccccgcgcatcgtgctgaacggcgactggcggttc
cgcctctcccccaccccgcgcggcctctccgacgagatggccgaccccgcgttcgacgac
tccggctgggacgagatccccgtgccgagccactgggtgctcggccaggacggccgcttc
ggcctccccgcctacacgaacgtgcagtacccgttccccgtcgagccgcccttcgtgccg
gacgagaaccccacgggcgactaccgcgtcgaggtcgacgtgcccacggactggcagtcg
ctcgagcgcgtcgtgctccggttcgagggcgtcgagtcggcgttcaaggtgtggctgaac
ggcgaggaggtcggcaccgcgatgggatcccgcctctcgcacgagttcgacgtcaccgcg
tcgctccgccccggatccaacgtgctcgccgtgcgcgtgcaccagtggtcgatcgccagc
tacctcgaggaccaggaccagtggtggatgcccggcatcttccgtgacgtcaccctcctc
ggccgtcccgagggcggcatcgacgacgcgtggacccgcgccgagtacgaccacgagacg
ggcgcgggcacggtgcacgtcgaggtcgacgccgagccgaccgcgttccccgtcacgttc
gaggtcgatggcctcgggatccacgtcacatgggacaccccggccgacgtcgcgcccgtg
cacgtcgaccgcgtcgagccgtggagcgccgagagccccacgcagtaccagggcttcctc
cgcaccaacgtcgaggcgctctccatccgcctcggcttccgcaccgtgcgcatcgagggc
gaccggttcctcgtcaacggccgccgcgtcgtcttccacggcgtcaaccggcacgaggcc
caccccgagcgcggccgcgtcttcgacgaggagcacgcgcgcgccgacatgctgctgatg
aagcagcacaacgtcaacgcgatccgcaccagccactacccgccgcacccccgcgtgctc
gacctcgccgacgagctcggcttctgggtcatcgacgagtgcgacctcgagacccacggc
ttcgagttcggcggctgggtcggcaacccgagcgacgacccgcgcttcgccgaccactac
ctcgaccggatcgagcgcacgatcgagcgggacaagaaccacccctcgatcgtcatgtgg
tcgctcggcaacgagtcgggcacggggcgcaacctcgccgcgatgtcggcttgggtccac
cgccgcgacccgggccgccccgtgcactacgagggcgactacacgggcgagtacacggac
gtctactcgcgcatgtactcgaacctgcaggagacggagtccatcggcagcgacgtgatc
ccgggcgacctgctcggctgcacgcccggcgagggcatgcgccagcgcaccaagcccttc
atcctctgcgagtacgtgcacgcgatgggcaacggccccggccagatcggcgagtacgag
gacctcgtgctccgctacccgcgcctccacggcggcttcgtgtgggagtggcgcgaccac
ggcatcctcaccgagacagcggacggcgaggcgttctacgcctacggcggcgacttcggc
gaggtcgtgcacgacggcaacttcgtgatggacggcatggtcctgcccgacgacaccccc
acgcccggcctcgccgagtacaaggccgtcgtgcagcccatcgcgttcgggctcgagcgc
gacggcggatccgcgtccctcgtggtcgagaaccgctaccactccgtctccaccgcgctc
acgagcctcgtctgggtgctcgcggtcgacggcgacgacgtggcgaccggggtcctggac
gccgaggccgtcccggccggcgacaccgcgcggatcccgctgcccgccgacgcgctcgac
gcgggcgagctggccggcgacggctccgaggtgtggctgaccgtgcaggcgatcctccgc
gacgacgagccgtgggccgaggccggccacgtggtcgccgtgcagcagttcgacctcacg
ccggcgccgcggcccgccgtgcccgcgcgctgggtcgacgccgacgaggagacgtacccc
gcgtccggcgccacgcgcctcaccctcggcgacggcgagttcgacctcgccaccggccgc
ctcgtgcgactcggctcgctcgaggtcgacggaccgcggctggagctgtggcgcgcgccc
accgacaacgaccgcagcgacagcagcggctcctacgagctggcggatccgcgtctcacc
ttcggcaagggcgtccccggcccgtcgagcgaggcacgctggcgcggcgcgggcctcgac
cggctgacgcaccgggtccgctcggtgaaggtcggctccggctcgctcacggtcgtcgtg
cgcacgagcgcggcgcagtccttcgactcggtcgacacgacgtactgctggaccgagggc
gccgacggcgacctggacctccgcgtcgacatcgtgccgagcgccggctgggccatcacc
tggccgcgcgtcgggatccgcttcgacctgcccgcgagcgtcaccaacgcggagtggttc
ggcaccgggcccttcgagtcgtaccccgactctcgccgcgcggcgctcgtcggccggttc
tcgtcgctcgtcgacgacctgggcgccgtctactcgatgccccaggagaccggccaccgc
agcgacctgcgcgagctcgagctcggcacgttcgacggcgaggacggcatcgtgatccag
gcccggcccgacaccgcgggccgccgccccggtttcacggcctcgcgccacacgccgcag
gagctcgaccgcgccgcgcacccgcacgagctgcccgccagcgaggcggtgcacctctac
atcgacgccgcgcagcacgggctcggctcgcgcgcgtgcggcctcgacgtgctgcccgag
caccagctgtggccgtcggcgcgcacgctggagctcaccatccgcagccgctga

DBGET integrated database retrieval system