KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_2126Help
Entry
CMM_2126          CDS       T00529                                 

Definition
(GenBank) putative Zn-dependant alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
cmi00010  Glycolysis / Gluconeogenesis
cmi00071  Fatty acid degradation
cmi00350  Tyrosine metabolism
cmi00625  Chloroalkane and chloroalkene degradation
cmi00626  Naphthalene degradation
cmi01100  Metabolic pathways
cmi01110  Biosynthesis of secondary metabolites
cmi01120  Microbial metabolism in diverse environments
cmi01130  Biosynthesis of antibiotics
cmi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CMM_2126
  Lipid metabolism
   00071 Fatty acid degradation
    CMM_2126
  Amino acid metabolism
   00350 Tyrosine metabolism
    CMM_2126
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CMM_2126
   00626 Naphthalene degradation
    CMM_2126
Enzymes [BR:cmi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CMM_2126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C UDPG_MGDP_dh_N Methyltransf_11 Methyltransf_25 3HCDH_N Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: CAN02195
UniProt: A5CSX1
Position
2400540..2401580
Genome map
AA seq 346 aa AA seqDB search
MRAVVYERFGETPVVRELPDPVPSAAGVVVRVEATGVCRSDAHGWLGHDDGIELPQVPGH
ELVGRIHEVGPEVTRFQVGDRVTVPFVCACGRCGECRAGNGQVCRDQTQPGFTHWGSFAE
LVALHDADVNLIPVPDDLDAGAAALLGCRFATAFRGLVHRARIQRGERLLVIGCGGVGLS
AVMIGVAVGAEVIAVDVDPAALARASELGAEYTIDSSDLSELDVLDAIHAVSPDGVQVSV
EALGRESTLRISLLALAPTGRQVQIGLFASEPTVPVPFVISQELSLHGSHGMPAHDYAEL
MEMVASGALRPELLIEHRITLDEAPAALEALASGDRSKGITLVEVG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgtcgtctacgagaggttcggcgagacgcccgtcgtccgcgagctgccggat
cccgtcccgtccgccgccggcgtcgtcgtgcgcgtcgaggcgacgggcgtctgccgcagc
gacgcgcacggctggctcggccacgacgacggcatcgagctcccgcaggtgcctgggcac
gagctggtcgggcggatccacgaggtcggccccgaggtcacgcgcttccaggtgggcgac
cgcgtcaccgtcccgttcgtctgcgcgtgcggccgctgcggcgagtgccgcgccgggaac
gggcaggtgtgccgcgaccagacgcagccgggcttcacgcactggggctcgttcgccgag
ctggtcgccctgcacgacgccgacgtgaacctgatccccgtgcccgacgacctcgacgct
ggcgccgcggcgctcctcggctgccgcttcgccacggccttccgcgggctcgtgcaccgg
gcccggatccagcgcggcgagcgactcctcgtcatcggctgcggcggcgtgggcctcagc
gcggtgatgatcggcgtcgcggtcggcgcggaggtcatcgcggtcgacgtggatcccgcc
gccctcgcgcgcgcctcggagctcggcgccgagtacacgatcgactcgtccgacctctcg
gagctcgacgtgctggacgcgatccacgcggtgtcgcccgacggcgtccaggtgtcggtg
gaggcgctcggtcgcgagtcgaccctccggatcagcctgctcgcgctcgcgccgaccggc
cggcaggtgcagatcggcctgttcgcgagcgagccgacggtgcccgtgccgttcgtcatc
agccaggagctgagcctgcacggcagccacggcatgcccgcgcacgactacgccgagctg
atggagatggtcgcgtcgggcgcgctccgcccggagctgctcatcgagcaccgcatcacc
ctcgacgaggccccggccgcgctcgaggcgctcgcgtcgggcgaccggtcgaaggggatc
acgctggtcgaggtgggctga

DBGET integrated database retrieval system