KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_2126Help
Entry
CMM_2126          CDS       T00529                                 

Definition
putative Zn-dependent alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CMM_2126
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CMM_2126
  Lipid metabolism
   00071 Fatty acid degradation
    CMM_2126
  Amino acid metabolism
   00350 Tyrosine metabolism
    CMM_2126
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CMM_2126
   00626 Naphthalene degradation
    CMM_2126
Enzymes [BR:cmi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CMM_2126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2400540..2401580
Genome map
AA seq 346 aa AA seqDB search
MRAVVYERFGETPVVRELPDPVPSAAGVVVRVEATGVCRSDAHGWLGHDDGIELPQVPGH
ELVGRIHEVGPEVTRFQVGDRVTVPFVCACGRCGECRAGNGQVCRDQTQPGFTHWGSFAE
LVALHDADVNLIPVPDDLDAGAAALLGCRFATAFRGLVHRARIQRGERLLVIGCGGVGLS
AVMIGVAVGAEVIAVDVDPAALARASELGAEYTIDSSDLSELDVLDAIHAVSPDGVQVSV
EALGRESTLRISLLALAPTGRQVQIGLFASEPTVPVPFVISQELSLHGSHGMPAHDYAEL
MEMVASGALRPELLIEHRITLDEAPAALEALASGDRSKGITLVEVG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgtcgtctacgagaggttcggcgagacgcccgtcgtccgcgagctgccggat
cccgtcccgtccgccgccggcgtcgtcgtgcgcgtcgaggcgacgggcgtctgccgcagc
gacgcgcacggctggctcggccacgacgacggcatcgagctcccgcaggtgcctgggcac
gagctggtcgggcggatccacgaggtcggccccgaggtcacgcgcttccaggtgggcgac
cgcgtcaccgtcccgttcgtctgcgcgtgcggccgctgcggcgagtgccgcgccgggaac
gggcaggtgtgccgcgaccagacgcagccgggcttcacgcactggggctcgttcgccgag
ctggtcgccctgcacgacgccgacgtgaacctgatccccgtgcccgacgacctcgacgct
ggcgccgcggcgctcctcggctgccgcttcgccacggccttccgcgggctcgtgcaccgg
gcccggatccagcgcggcgagcgactcctcgtcatcggctgcggcggcgtgggcctcagc
gcggtgatgatcggcgtcgcggtcggcgcggaggtcatcgcggtcgacgtggatcccgcc
gccctcgcgcgcgcctcggagctcggcgccgagtacacgatcgactcgtccgacctctcg
gagctcgacgtgctggacgcgatccacgcggtgtcgcccgacggcgtccaggtgtcggtg
gaggcgctcggtcgcgagtcgaccctccggatcagcctgctcgcgctcgcgccgaccggc
cggcaggtgcagatcggcctgttcgcgagcgagccgacggtgcccgtgccgttcgtcatc
agccaggagctgagcctgcacggcagccacggcatgcccgcgcacgactacgccgagctg
atggagatggtcgcgtcgggcgcgctccgcccggagctgctcatcgagcaccgcatcacc
ctcgacgaggccccggccgcgctcgaggcgctcgcgtcgggcgaccggtcgaaggggatc
acgctggtcgaggtgggctga

DBGET integrated database retrieval system