KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_2137Help
Entry
CMM_2137          CDS       T00529                                 

Definition
putative sugarkinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CMM_2137
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CMM_2137
   00052 Galactose metabolism
    CMM_2137
   00500 Starch and sucrose metabolism
    CMM_2137
   00520 Amino sugar and nucleotide sugar metabolism
    CMM_2137
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CMM_2137
   00524 Butirosin and neomycin biosynthesis
    CMM_2137
Enzymes [BR:cmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CMM_2137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2413422..2414360
Genome map
AA seq 312 aa AA seqDB search
MPRTLALAVDFGGTKVESALVDDAGRVLEGSRFRGPTGPERSADELLDAVLGVARQALAA
LPDDAELVGTGLAAAGPVDVPHGLVSPLNVPAWRDYPLRDRLAELTPDVPTTLQMDGLAI
TLAEHWVGAGRGHDHVMGMIVSTGIGGGLVLGGRTAAGSTGNAGHIGHVEVAGFDDPCTC
GGQGCVEAIASGPKSVAWARAQGWTGSTGEDLAASYRDGDETAVAAVRRAGLAIGRAIAS
ASSLVDLDVVAIGGGFSRVTPDLFDMIREPIALREQFGFVTKTRVVPSGLSADGPIIGAG
ALVHRREMVPSF
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgcacgctcgcgctcgccgtcgacttcggcggcaccaaggtcgagtccgcgctc
gtggacgacgcgggccgcgtgctcgagggcagccgattccgcgggccgacgggccccgag
cgctccgccgacgagctgctcgacgccgtcctcggcgtcgcccgccaggcgctcgccgcc
ctgcccgacgacgccgagctcgtcggcacgggcctcgccgccgccggcccggtcgacgtg
ccgcacggccttgtctcgccgctcaacgtgcccgcctggcgcgactacccgctgcgcgac
cgcctggccgagctcacgcccgacgtgcccaccacgctgcagatggacggcctcgccatc
accctcgccgagcactgggtcggcgccggcaggggccacgaccacgtgatgggcatgatc
gtctccaccgggatcggcggcgggctcgtgctcggcggccgcaccgcggcgggatccacg
ggcaacgccggccacatcggccacgtcgaggtcgccgggttcgacgacccgtgcacgtgc
ggcggccaggggtgcgtcgaggccatcgcgtcggggccgaagagcgtcgcgtgggcgcgc
gcgcagggctggacgggatccaccggcgaggacctcgcggcctcctaccgcgacggcgac
gagacggccgtcgcggctgtccgtcgcgcgggcctcgccatcggccgcgccatcgcgtcc
gccagctcgctcgtagacctcgacgtcgtggcgatcggcggcgggttcagccgcgtcacg
cccgacctcttcgatatgatccgcgagcccatcgccctccgcgagcagttcggcttcgtg
accaagacgcgcgtcgtgccctccggcctctcggcggacggcccgatcatcggcgcgggc
gcgctcgtgcaccgccgggagatggtcccgagcttctga

DBGET integrated database retrieval system