KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_2160Help
Entry
CMM_2160          CDS       T00529                                 

Gene name
dxrA
Definition
(GenBank) putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
cmi00900  Terpenoid backbone biosynthesis
cmi01100  Metabolic pathways
cmi01110  Biosynthesis of secondary metabolites
cmi01130  Biosynthesis of antibiotics
Module
cmi_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CMM_2160 (dxrA)
Enzymes [BR:cmi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CMM_2160 (dxrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom Sacchrp_dh_NADP Semialdhyde_dh FCD Epimerase
Motif
Other DBs
NCBI-ProteinID: CAN02230
UniProt: A5CT05
Position
complement(2439980..2441062)
Genome map
AA seq 360 aa AA seqDB search
MRRVIILGSTGSIGVQALEVVARHPELFEVVGLGAGSKREALAEQARVAGVEHTALGADE
AEQLIRSVDADVVLNGITGSVGLGPTLAALEEGRTLALANKESLIVGGELVRSLAAPGQL
VPVDSEHSAIAQALRGGTAEEVRRLVVTASGGPFRGRTRAELEHVTPREALAHPTWDMGL
VITTNSSTLVNKGLEVIEAHLLFDVPYERIDVVVHPQSMIHSMVEFIDGSTLAQASPPDM
RLPIALGLNWPHRMHDVGVPIDWTRAATWTFEPLDDEAFPAVLLAKQVGAAGSTYPAVYN
AANEQAVQAFHSGRAGFLDIVDTIRRVVDAHEPASGPLTRESLAEAERWARAEADRVLGV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgggtcatcatcctcggatccacgggttccatcggcgtgcaggccctcgaggtc
gtcgcccggcacccggagctgttcgaggtcgtggggctcggcgccggcagcaagcgcgag
gcgctcgccgagcaggcgcgcgtcgcgggcgtcgagcacacggccctcggcgcggacgag
gcggagcagctcatccgctcggtcgacgcggacgtggtgctgaacggcatcaccggatcc
gtggggctcggccccaccctcgccgcgctggaggagggccgcaccctcgccctcgccaac
aaggagtccctcatcgtcggcggcgagctggtgcgctcgctcgccgcgccgggtcagctc
gtccccgtcgactcggagcactccgccatcgcccaggcgctccgcggcggcacggcggag
gaggtcaggcggctcgtcgtcacggcgtccggcggcccgttccgcggccgcacgcgcgcc
gagctggagcacgtgaccccgcgcgaggcgctcgcccatcccacatgggacatgggcctc
gtcatcaccacgaactcgtcgacgctcgtgaacaagggcctcgaggtcatcgaggcgcac
ctcctgttcgacgtgccctacgagcggatcgacgtggtcgtgcacccgcagtcgatgatc
cactccatggtcgagttcatcgacgggtcgacgctcgcgcaggcgtccccgccggacatg
cgcctcccgatcgcgctcgggttgaactggccgcaccgcatgcacgacgtcggcgtgccc
atcgactggacccgcgcggcgacgtggacattcgagccgctcgacgacgaggccttcccg
gccgtgctgctcgccaagcaggtcggtgcggcgggatccacctacccggccgtctacaac
gcggcgaacgagcaggccgtgcaggcgttccactcggggcgcgcggggttcctcgacatc
gtggacaccatccgccgggtcgtcgacgcccacgagccggcgtccgggcccctcacgcgc
gaatcgcttgccgaggccgagcgctgggcgcgcgccgaggccgaccgcgtgctcggggtc
tga

DBGET integrated database retrieval system